KEGG   Desulfomicrobium baculatum: Dbac_2129Help
Entry
Dbac_2129         CDS       T00963                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00010  Glycolysis / Gluconeogenesis
dba00030  Pentose phosphate pathway
dba00051  Fructose and mannose metabolism
dba00052  Galactose metabolism
dba00680  Methane metabolism
dba01100  Metabolic pathways
dba01110  Biosynthesis of secondary metabolites
dba01120  Microbial metabolism in diverse environments
dba01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dbac_2129
   00030 Pentose phosphate pathway
    Dbac_2129
   00051 Fructose and mannose metabolism
    Dbac_2129
   00052 Galactose metabolism
    Dbac_2129
  Energy metabolism
   00680 Methane metabolism
    Dbac_2129
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dbac_2129
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Dbac_2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACU90213
UniProt: C7LNY9
Position
complement(2437255..2438358)
Genome map
AA seq 367 aa AA seqDB search
MGLQRVGILTGGGDCSGLNAVIRAVTRTAIIQYGAEVLGLENGFDGLIFGRTMRLTTGNT
KDILTLGGTILGTTNKGNPFAYREFDEDGHITVRDLSAQAMDTFTSQGLDCLFVVGGEGT
LELAHKFQQMGMPVVGIPKTIDNDLEGTDYTFGFQTAVQVACDAMDRLHTTGRSHDRVMI
LEVMGRNAGWIALEAGLAGGAHIILIPEIPYNLDNVVAKIQHRIRGKSPFSIIMVAEGAR
EEGGERITQSTATTRLQGVEQLGGVGFHLACRIRERIPLEVRTTVLGHIQRGGSPTAFDR
VLGTRLGAAAVDAAARGDFGTMVALKTPDIVLVPLSELAGLCRTVPVDHQLIRAAEATGV
NLGRGAM
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgcagcgtgttggaattctgaccggcggcggtgattgctccggcctcaacgcc
gtgatcagggccgtgacccggacggcgatcatacagtacggagctgaagtgctggggctt
gagaacggtttcgacggactcatcttcggccggaccatgcggctgaccaccggcaacacc
aaggacattctgaccctgggcgggacgatcctcggcaccaccaacaagggcaaccccttc
gcctaccgcgagttcgacgaagacgggcatatcacggtccgcgacctttccgcgcaggcc
atggatacgttcacgtcgcaggggctggattgcctcttcgtggtcggcggtgaaggcacc
ctggagctggcgcacaaatttcagcagatgggcatgcccgtggtcggcatccccaaaacc
atcgataatgacctcgaaggcacggactataccttcggtttccagaccgccgtgcaggtg
gcctgtgacgccatggaccgtctgcacacgaccggtcgcagtcacgaccgggtcatgatc
cttgaggtcatgggccgcaacgccgggtggatcgccctggaggcggggctggccgggggc
gcgcatatcatcctcatccccgagattccctacaacctcgataacgtggtggccaagatc
cagcaccgcatccgcggcaagagtccgttcagcatcatcatggtggcggaaggggccagg
gaggagggcggggagcgcatcacccagagcacggccacgacgcggctgcagggcgtggag
caactgggcggcgtcggctttcatctggcctgccggatcagggaacggattccgctggaa
gtgcgcaccactgtgcttggccatatccagcgcggcggatcgcccacggcctttgaccgg
gtgctgggcacgcggctgggcgcggcggccgtggatgctgcggcacgcggggattttggg
accatggtggccctcaaaaccccggacatcgtgctcgtgcctctctcggagctggccggg
ctgtgccgcaccgtgccggtggatcatcagctcatccgcgcggccgaggccacgggcgtg
aacctggggcgcggggccatgtag

DBGET integrated database retrieval system