KEGG   Desulfomicrobium baculatum: Dbac_2129Help
Entry
Dbac_2129         CDS       T00963                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dba  Desulfomicrobium baculatum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dbac_2129
   01230 Biosynthesis of amino acids
    Dbac_2129
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dbac_2129
   00030 Pentose phosphate pathway
    Dbac_2129
   00051 Fructose and mannose metabolism
    Dbac_2129
   00052 Galactose metabolism
    Dbac_2129
  Energy metabolism
   00680 Methane metabolism
    Dbac_2129
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dbac_2129
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dbac_2129
Protein phosphatases and associated proteins [BR:dba01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dbac_2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2437255..2438358)
Genome map
AA seq 367 aa AA seqDB search
MGLQRVGILTGGGDCSGLNAVIRAVTRTAIIQYGAEVLGLENGFDGLIFGRTMRLTTGNT
KDILTLGGTILGTTNKGNPFAYREFDEDGHITVRDLSAQAMDTFTSQGLDCLFVVGGEGT
LELAHKFQQMGMPVVGIPKTIDNDLEGTDYTFGFQTAVQVACDAMDRLHTTGRSHDRVMI
LEVMGRNAGWIALEAGLAGGAHIILIPEIPYNLDNVVAKIQHRIRGKSPFSIIMVAEGAR
EEGGERITQSTATTRLQGVEQLGGVGFHLACRIRERIPLEVRTTVLGHIQRGGSPTAFDR
VLGTRLGAAAVDAAARGDFGTMVALKTPDIVLVPLSELAGLCRTVPVDHQLIRAAEATGV
NLGRGAM
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgcagcgtgttggaattctgaccggcggcggtgattgctccggcctcaacgcc
gtgatcagggccgtgacccggacggcgatcatacagtacggagctgaagtgctggggctt
gagaacggtttcgacggactcatcttcggccggaccatgcggctgaccaccggcaacacc
aaggacattctgaccctgggcgggacgatcctcggcaccaccaacaagggcaaccccttc
gcctaccgcgagttcgacgaagacgggcatatcacggtccgcgacctttccgcgcaggcc
atggatacgttcacgtcgcaggggctggattgcctcttcgtggtcggcggtgaaggcacc
ctggagctggcgcacaaatttcagcagatgggcatgcccgtggtcggcatccccaaaacc
atcgataatgacctcgaaggcacggactataccttcggtttccagaccgccgtgcaggtg
gcctgtgacgccatggaccgtctgcacacgaccggtcgcagtcacgaccgggtcatgatc
cttgaggtcatgggccgcaacgccgggtggatcgccctggaggcggggctggccgggggc
gcgcatatcatcctcatccccgagattccctacaacctcgataacgtggtggccaagatc
cagcaccgcatccgcggcaagagtccgttcagcatcatcatggtggcggaaggggccagg
gaggagggcggggagcgcatcacccagagcacggccacgacgcggctgcagggcgtggag
caactgggcggcgtcggctttcatctggcctgccggatcagggaacggattccgctggaa
gtgcgcaccactgtgcttggccatatccagcgcggcggatcgcccacggcctttgaccgg
gtgctgggcacgcggctgggcgcggcggccgtggatgctgcggcacgcggggattttggg
accatggtggccctcaaaaccccggacatcgtgctcgtgcctctctcggagctggccggg
ctgtgccgcaccgtgccggtggatcatcagctcatccgcgcggccgaggccacgggcgtg
aacctggggcgcggggccatgtag

DBGET integrated database retrieval system