KEGG   Desulfomicrobium baculatum: Dbac_2162Help
Entry
Dbac_2162         CDS       T00963                                 

Definition
MCP methyltransferase/methylesterase CheR/CheB (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dba  Desulfomicrobium baculatum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dba00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dbac_2162
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dbac_2162
Enzymes [BR:dba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Dbac_2162
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dbac_2162
Two-component system [BR:dba02022]
 CheA family
  CheA-CheYBV
   Dbac_2162
Bacterial motility proteins [BR:dba02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dbac_2162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2479137..2481776
Genome map
AA seq 879 aa AA seqDB search
MNSKSKQKGSPPLSHESVPPAHESAGPPIPIVGVGASAGGLEALEQFLGHVPEKSGMAFV
IVQHLDPTRKGLLPELLQRATAMPVHQVRDRMPVEADCVYVIPPNHDMSILHGVLHLFKP
AAPRGLRLPIDFFFRSLAEDQQERSIGVILSGMGSDGTLGLRAIKEKAGLALAQDPASAK
FDSMPRNVINAGLADLVAPVEELPAKLLDLMRHARVVTAFVPSLEEKTQSGLEKIVLLLR
TKTGHDFSQYKKNTLYRRIERRMSIHQIDGIMSYVRFLQENSQETEILFRELLIGVTSFF
RDPATWEHLQKNALPLLLKSCPPNGILRAWTPGCSTGEEAYSLAMVFRETVAHVAPESGI
KLRIFATDLDKDAIDKARRGLYPPNIAADVSAERLDQFFVHDEHGYRVGKDIREMITFAT
QNVIMDAPFTRLDILICRNLLIYLAPELQQKLLSLFHYSLNPDGVLFLGSSESINSSTDL
FAPIDSKSRLFRRRESIPTAAKIAFQPSFVPVLPGISQETTMLKPAVNIQSLADQVLLQH
FSPPAVLVNSKGDILYISGRTGKYLEPPAGKVNWNIHAMAREGLRFDLGVAFQNALRQKK
AVTVKGLKVTEGETVQTVDLTVQEIQEPAALRGMVMVIFTDVATPPKQKKARRSKPGDAG
SVKVTELEQELYQCREELRTTREEMQASQEELKSYNEEMQSTNEELQSTNEELTTSREEM
QSLNEELQTVNAEQQSKMDELARINDDMRNLLNSTEIVTIFLDNDLHVRRFTPGANKIFK
LIPGDVGRPLSDLASDLLYPEISEQAAEVLRTLAFSEKQVCTADGRWYVVRIMPYRTMQD
IIAGLVMTFTNITVAKELERKLRAENDELRLRLGAGGSS
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaaatccaagcaaaaaggctcgccacccctgagccacgaatccgtaccgcca
gcgcacgaatctgcgggaccccctatacccattgtcggagttggagcttccgccggtgga
ttggaagccctggagcaatttttagggcacgtgcctgaaaaaagcggaatggcctttgtc
atcgtccagcacctcgatccgacgcgcaagggcctcctgccggaactgctgcagcgcgcc
accgcgatgccggtgcatcaggtcagggacaggatgccggtcgaggcggactgcgtgtac
gtaatcccgcccaaccatgacatgtccatcctgcatggcgtgctgcatctgttcaaaccg
gccgcgcctcgcggcctgcgcctgcccatcgactttttcttccgctcgctggcagaggac
cagcaggagcgaagcatcggcgtcatcctgtccggcatgggctccgatggcacgctcggg
ctgcgggccatcaaggaaaaggcggggctggccctggcgcaggaccccgcctcggccaaa
ttcgacagcatgcccagaaacgtcatcaatgccgggctggccgatctggtcgctccggtg
gaagaattgcccgcaaagctgctcgacctgatgcgccatgcacgggttgtcaccgcgttt
gtcccctcgcttgaggaaaaaacccaaagcggcctcgaaaaaatcgtcctcctgctgcgc
acgaagaccggccatgacttttcccagtacaagaagaacaccttgtaccgtcgcatcgaa
cggcgcatgagcattcaccagatcgacgggatcatgtcctatgtccgctttctgcaggaa
aattcccaggaaaccgagattctgttcagggagcttctgatcggagtgaccagctttttt
cgcgatccggcgacatgggagcatctgcaaaaaaacgctctcccgcttctgctgaagtcg
tgtccgccgaatggcattctgcgggcctggacaccgggctgctccacaggggaggaagcc
tattcgctggccatggtcttcagggagaccgtggctcacgtggcgccggagtcgggcatc
aagctgcgcatctttgccacggacctggacaaggacgccatcgacaaggcccgccgcggc
ctctatccgccaaatatcgctgcggatgtttccgccgaacggctggatcaatttttcgtt
catgacgaacacggttatcgcgtcggcaaagatatccgggaaatgatcaccttcgccacg
cagaatgtcatcatggacgccccgttcaccaggcttgatatcctcatctgccgcaatctc
ctgatctatcttgcgccggagttgcagcagaagctgctgtcactttttcattacagtctg
aatccggatggagtcctgtttttgggaagttcggaatcgatcaactccagcaccgatctc
tttgctccgatagacagcaaatcaaggctgtttagacgacgcgaatcaatcccgacggcc
gcaaagattgcattccagccttcattcgtcccggtcttgccgggcatttcacaggagacc
acaatgctcaaaccggcggtcaatatccagtctctggcggatcaggtgctgttgcagcac
ttttcaccgcccgccgtgctggtcaacagcaagggggatatcctctacatcagcggcagg
acgggcaaataccttgaaccgccggcgggcaaggtcaattggaatatccacgccatggct
cgggaaggactgcgcttcgacctgggggtcgcctttcaaaatgccctgaggcagaagaag
gcggtcacggtcaagggactcaaagtcacagaaggtgaaacggttcagaccgtggacctc
accgtgcaggaaattcaggaacctgcggccctgcgcggcatggtcatggtcatcttcacc
gacgtggcgacccctccaaaacaaaaaaaagcacgccgttcaaaacctggcgatgcagga
agcgttaaggtcacggagctggaacaggagctgtatcaatgccgcgaagaacttcggacc
acacgcgaagaaatgcaggcttcacaggaagaactcaaatcctacaacgaagagatgcag
tctacaaacgaggaactgcagtctacaaatgaggaattgaccacctctcgtgaagagatg
caatcactcaatgaggagctgcagacggtgaacgccgagcagcaatcaaagatggacgag
ctcgcgcggatcaatgacgacatgcgcaacctgctcaacagcacggagatcgtcacgatt
tttctcgacaacgacctgcacgtccggcgcttcactcccggcgccaacaagatcttcaag
ctcatccccggcgatgtgggccggcccctctccgatcttgccagcgacctgctctatccc
gaaatatccgagcaggcggcagaggtgctcagaaccctggcattttcggaaaaacaggtt
tgcaccgccgacggtcgctggtatgtggtgcgcatcatgccctacagaaccatgcaagac
attatcgcaggcctggtcatgaccttcacgaacatcaccgtggccaaggagctcgaaagg
aaactgcgcgcagagaatgacgagctcaggcttcggctcggcgcaggaggatcatcatga

DBGET integrated database retrieval system