KEGG   Desulfomicrobium baculatum: Dbac_2255Help
Entry
Dbac_2255         CDS       T00963                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dba  Desulfomicrobium baculatum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dbac_2255
   00030 Pentose phosphate pathway
    Dbac_2255
   00051 Fructose and mannose metabolism
    Dbac_2255
   00052 Galactose metabolism
    Dbac_2255
   00500 Starch and sucrose metabolism
    Dbac_2255
   00520 Amino sugar and nucleotide sugar metabolism
    Dbac_2255
  Nucleotide metabolism
   00230 Purine metabolism
    Dbac_2255
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dbac_2255
Enzymes [BR:dba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dbac_2255
    5.4.2.8  phosphomannomutase
     Dbac_2255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2596384..2597736)
Genome map
AA seq 450 aa AA seqDB search
MNLSCFKAYDIRGRVPDELDEALAYRIGRAYAAFLNPDRVVVGHDIRLSSPAMADAVIRG
LRDSGVDVCTLGECGTEEVYFAVFDQGLDGGIMVTASHNPKDYNGMKLVREESRPISGDT
GLFAIRDLAVAGEFRAAQRVGQLYELNMRPRYIDHLLSYVDRDVLRPLSIVVNAGNGGAG
VIVDLLQHKLPFRFHKLLHKPDGNFPAGVPNPLLPENRELTARAVLEHKADLGLAWDGDF
DRCFFFDGSGRFIEGYYLVGLLGEAFARKVPGAGIIHDPRLTWNTIAAVSAAGGRPIMSK
TGHAFIKERMRLEDAVYGGEMSAHHYFRDFAYCDSGMIPWLLVAEQISRTGKSLAELVDE
AMAAYPASGEINRRVKDAGAAIAAVEARFAAQSLRRDETDGLSLEFDQWRFNLRSSNTEP
VLRLNVESRGDRTLMEEKTREILEVVDGMD
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttcctgtttcaaagcctacgatattcgcggacgcgtcccggacgagctggat
gaagccctggcgtatcgtatcggccgggcctatgccgcttttctgaatcccgaccgggtg
gtggtcggccatgacatccgcctttcaagccccgccatggcggatgccgtgatccgcggc
ctgcgcgattccggcgtggatgtgtgcaccctgggcgagtgcggcaccgaggaagtgtat
ttcgccgtctttgatcaggggcttgacggcggcatcatggtcaccgccagtcacaatccc
aaagattacaacggcatgaagctcgtgcgcgaagagtcccgccccatcagcggcgacact
ggccttttcgccatccgcgacctggcggtggccggagaattcagggccgcgcaacgggtc
ggtcagttgtacgaactgaacatgcgcccgcgctatatcgaccatcttttgtcctatgtg
gatcgcgatgtgctgcgacccctgtccatcgtggtcaatgccggaaacggcggagccggg
gtcatcgttgacctgctccaacacaagctgcccttcagattccataagctgctgcacaag
cccgacggcaattttccggccggcgtgcccaacccgttgctgccggaaaacagggaattg
accgcccgggcggtgctcgaacacaaggcggacctggggctggcctgggacggggacttc
gaccgttgttttttctttgacggcagcgggcgcttcatcgaaggctattatctggtgggt
cttctgggcgaggccttcgcccgcaaggttccgggggcgggcatcatccacgatccgcgc
ctgacctggaacaccatcgccgccgtgagcgccgcaggaggccggcccatcatgtccaag
accgggcacgctttcatcaaggagcgcatgcgcctggaagacgcggtctacggcggggag
atgagcgcgcaccattatttccgtgatttcgcctattgcgattcgggcatgatcccctgg
ctcctggtcgctgagcagatctcgcgcacgggcaagtcgctggccgagctggtggacgag
gctatggccgcgtatccggccagcggagagatcaaccgccgggtcaaggacgcgggcgcg
gccattgccgccgtggaggcgcggtttgccgctcaaagcctgcgtcgtgacgaaaccgac
ggtttgagccttgagtttgatcagtggcgcttcaacctgcgctcatccaacaccgaaccg
gtgctgcgtctcaacgtcgagtcgcgcggggaccggacgctcatggaggagaagacgcgg
gagatcctggaggttgtggacgggatggactga

DBGET integrated database retrieval system