KEGG   Desulfomicrobium baculatum: Dbac_2472Help
Entry
Dbac_2472         CDS       T00963                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dba  Desulfomicrobium baculatum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dbac_2472
Enzymes [BR:dba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Dbac_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2839369..2840343
Genome map
AA seq 324 aa AA seqDB search
MNPRVIGTVRSHLVSREQCPKYGDASMPPVWIELAPDFEPAATDLQVGDSILVLTWMHQG
DQSVLRCHPQGNRELPMRGIFSTRSPDRPTPIGLHAVRILGREGLRLKVHPLEVIDGTPV
IDIKPDNTPCPAQTEFSSLVNPDTGQAILTAGRDGWQRGLFAGFNGNVSIRQGERVVITA
TGSAKGHLSPKDLAVVDLSTGTPVSSVRASSEIAVHLEVYRNQPRAKAIVHTHPPKLLAL
SLRGEGPLLDLPLFEGRVFADKLTRVPAHRPGTVELAQAVGQASRDFEAVFMDNHGLVCW
GDSMIQALGLSEELESLAGIAMTR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcgcgtcatcggcaccgttcgctcccatctcgtaagccgcgagcagtgcccc
aaatacggcgatgcctcgatgcctccggtctggattgaactggctccggattttgaaccc
gcagccacggacctgcaggtcggagactccattctggtcctgacctggatgcaccagggc
gaccagagcgtgctgcgctgccaccctcagggaaaccgcgaactgcccatgcgcggcatc
ttctcgacccgctccccggaccgccccacgcccataggcctgcatgcggtgcgcatcctc
ggccgcgagggactgcgcctcaaagtgcatcccctggaggtcatcgacggtacccccgtc
atcgacatcaagcccgacaacaccccctgcccggcccaaaccgaattctcatccctggta
aatcccgacacgggccaggccatcctaacggccggccgcgacggctggcagcgcggcctc
ttcgccggattcaacggcaacgtgagcatacgccagggagaacgcgtcgtgatcacggcg
acaggcagtgccaaagggcatctctcccctaaggacctggccgtggtcgacctgtccacg
ggaacacccgtgtcatcggtgcgggcctcatcggaaattgccgtgcatcttgaggtctat
cgtaatcagccccgggcaaaggccatcgtgcacacccacccgccaaagcttctggctctg
tccctgcgcggcgagggtcctctgcttgacctcccgctctttgaaggccgggtcttcgcc
gacaagctgacccgcgtgcccgcccaccggcccggcactgtggaactggcccaggccgtg
ggccaggccagccgggacttcgaagccgtgttcatggacaaccacggactggtctgttgg
ggggactccatgatccaggcgctgggactctccgaagaactggagagcctggccgggatc
gcgatgacgcgctaa

DBGET integrated database retrieval system