KEGG   Desulfomicrobium baculatum: Dbac_2556Help
Entry
Dbac_2556         CDS       T00963                                 

Definition
hypothetical protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
dba  Desulfomicrobium baculatum
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dbac_2556
Enzymes [BR:dba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dbac_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2913350..2916763)
Genome map
AA seq 1137 aa AA seqDB search
MQAICVKYIEILILNESKKYKMKFTKESLMLLLVSIIVSFYSSHASASGQNLKDLEIDHD
LTLSFETPHTKWAKPYAGGRIKVLFFSSTENNTVRECVELIQRFDIECKAIFWTKISGDK
KREINWHGGNLGRQRMTNLLKNKWDCFVFFGVSVSDLPAIQKEMVMNAVTRGAGLVSVEA
DNQKLRLKKNGELPISDFIVDENTRKATLLGKGREIVVSACPQLNFTEGWEITYDYWQES
LGRAVLWAAQQEPMTRLRLDVTAGEAYSGQSREIQVGRPATLNADFSGKPFGTDHRIRIS
VRKPGHAARVLPEQSITFGATAVFKLPSLPEGIWRADAVVVGSLGVETWASQPFVVSSER
TVTGLSVSKYWAEPGESISGKVFVSGVPLINEIVRIQLLDSRRRELVRQDIPANGNEVEF
VFDIAKWMPMLVTVEARLLSNNVEISRTHRYVRVAKRQRDRFNFLIWGVPKGTLAPYAEE
SLARQGVTLQLDWENPPLHVAANDISWIPFTTHIPAEKKSNGVMKPFCWNDGLAVWKQTA
MLASIHRRSREHGVFVYSIGDENKTKGSCISKFCTNTYQVFLQESYSTLDALNRSWGTDF
ERWKDVGLLNSTDDDELASLALKNYPRWFDRQAYKSWNYVQYCLKYSKAYKGIDPQAKTG
FDGAAGFATGDDIDLIIRSLDSWVPYQSIADEVIRSIAPREFIRSNWIGGRDKTSGPLLY
KYWRLVNLGADSIWWWMWSCIGDLRGFLAPDLRPFPEIEEVVEDTRMVRDGLGDLLLQSV
MLDDDIAILYSYPSVFAHKLDEGASFGSYEEAHSSLIKFIRNSGYQFRYITDRMLRQSET
DLSKFRMLFLPRAEAISDKEAELIRQYVAGGGTVVADLRPGLYDDHCKRREKGILDDMFG
IKQAEKNKIFTLGQVIVRSVGKGRAILLNNKMSSLPALMAGETLIRDFWGGAPAIKIHGK
MNGLEVTRWRNQGIEILSLLREGVEVEGVTVSLPKSKYIYDLRAFRSYGLTDHFDTNIIP
NRASFFALTDRHIAQPVVSLHLSEARQGMMAQMVVEVPDAEGKHALKMGVKVDGNHVDWF
DKVVLVGAEPVTVELPIAYNDPVGNYSIEFTDLFSGKKSQVKFNVSSFGQKELSQAD
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctatttgtgtaaaatatattgagatattaattttgaacgaaagcaaaaaatat
aaaatgaaattcacaaaagaatcactgatgcttttattggtgtcaatcattgtttctttt
tattcatcgcatgctagtgcttcaggtcaaaatttaaaagaccttgagattgatcatgat
ttaacattatcttttgaaacacctcatactaaatgggcaaagccttatgctggtggaaga
attaaagttctatttttttcaagtactgaaaataatactgttcgtgaatgtgttgagctt
attcaacgttttgatatcgaatgtaaggcaattttttggacaaaaataagtggtgataag
aaaagagaaattaattggcatggaggtaatctaggtagacagagaatgactaatttgctg
aaaaataaatgggattgtttcgtttttttcggggttagtgtaagtgatcttccggcgata
caaaaagaaatggtcatgaatgctgttactcgcggtgctggattggtgtctgttgaagct
gataaccagaaattgcgtctcaaaaaaaacggtgaattgccgatatctgattttatagtt
gatgaaaatacaagaaaagctactttgttgggtaaaggtagagaaatagttgtctctgca
tgccctcaacttaattttactgaggggtgggagattacctacgactactggcaggaaagt
cttggtcgagcagttctgtgggcagcccaacaagagcctatgactcgtctcaggctggat
gtcactgcgggtgaagcctattcaggtcaaagccgggagatacaggttggaaggcctgcc
actttgaatgctgatttttctggaaaaccatttgggactgatcatcgtatacggatttca
gtgcggaaaccgggtcatgctgctcgtgttttgccggaacaaagcatcacatttggagcg
accgccgtatttaaattaccaagtcttcctgaaggcatttggcgtgcagatgcggttgtg
gtgggaagcttaggtgttgaaacttgggccagtcaaccgttcgtagtatcgtctgaaaga
accgttacaggcttgagtgtaagtaaatattgggctgagccaggagaatcaatttctggg
aaagttttcgtttccggagtcccgttaataaatgaaattgttcggatacaacttctagac
agtcgtcggcgtgaactggttcgccaagacattcctgcaaatggtaatgaagtagaattt
gtatttgatatagcaaagtggatgcctatgctcgttaccgttgaggcacgtctgctatcc
aataatgtggagatttctcgaacacacaggtatgttcgagttgccaagcgtcagcgggac
cgctttaattttctcatatggggagtaccaaaaggcactctggctccctatgcagaagag
agtctcgcacggcagggggttacacttcaacttgactgggagaacccaccactccacgtt
gcggccaatgacatttcttggatccccttcaccactcatattccggcagagaaaaaatcg
aatggcgtcatgaaaccattctgctggaatgatggcttggcggtctggaaacaaaccgca
atgctcgcttctatacacagaagatcacgagaacatggcgtctttgtgtattctatagga
gatgagaacaagacaaaaggatcttgtatatctaaattttgcactaatacataccaagtt
tttcttcaagagtcatatagtactttggatgctctcaatcgctcttggggtactgatttt
gaacggtggaaagatgtaggtctattaaattccaccgatgatgatgaattggcatcgtta
gctttaaaaaattaccctcgctggtttgaccgccaggcctataagtcttggaattacgtt
cagtactgtctgaaatactccaaagcatacaaaggtattgatccgcaagctaagaccggt
tttgatggtgctgctggatttgcgactggggatgatatagatttgatcatacgtagcctt
gattcctgggtcccctatcaaagtattgcagacgaggtcatacgctcaattgcaccaaga
gaattcatccgatctaactggattggtgggcgtgacaaaacatccgggcccctgttgtat
aagtattggcggcttgtaaatttgggcgcggactcgatctggtggtggatgtggagttgt
attggagacctgcgcggttttctcgctcccgatctcaggccatttcctgaaatcgaggag
gttgtcgaagatacacgtatggtcagggatggtttgggggacttgctgctccaatctgta
atgctggatgacgatattgcaatactctattcttatccttcagtctttgctcataagttg
gatgagggagcttcctttggttcatatgaggaagctcattcttcactcataaaatttata
cgaaattcggggtaccagtttcgctatataactgatcggatgctgcgccaaagcgagacg
gatctgtctaagtttagaatgctctttctcccacgcgctgaggctataagtgacaaggag
gcggaactaatccgacaatatgttgccggtggcggaacagtggtcgcggatttgagacct
gggctttatgatgatcattgtaaaaggcgtgaaaaggggattcttgatgacatgtttgga
atcaaacaggccgaaaaaaacaaaatttttacgttaggacaggtgatagttcgtagcgtg
ggtaaggggcgtgccattcttctcaataacaaaatgagcagcttgcccgcgttaatggcc
ggagagactctcatcagagatttttgggggggcgcccctgcgattaaaattcatggaaaa
atgaacggcttggaggttacgcggtggcgcaatcaggggattgagattttatccttgctt
cgcgagggagtcgaagtggaaggagtaacggtttccttgccaaagtcgaaatacatttac
gatctgcgagcctttcgctcctatggcctgaccgaccatttcgacacgaatattattccc
aatcgagcttcgttttttgctctgacagacaggcacatagcgcagcctgtagtaagcctc
catctttcagaggcgcgccaaggtatgatggcacaaatggtagtagaagtgccagacgcg
gagggcaagcacgcactcaagatgggtgttaaggtcgatggcaatcatgttgactggttt
gataaggtcgtactggtgggcgcagagcctgtcactgtagaattgccgatagcgtacaat
gatcctgttgggaattacagcatcgaatttaccgatcttttctctggtaagaagtctcag
gtaaaatttaacgttagttcgtttggtcagaaagaactttcgcaggctgattag

DBGET integrated database retrieval system