KEGG   Desulfomicrobium baculatum: Dbac_2557Help
Entry
Dbac_2557         CDS       T00963                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dba  Desulfomicrobium baculatum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Dbac_2557
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dbac_2557
Enzymes [BR:dba01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Dbac_2557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2916826..2917383)
Genome map
AA seq 185 aa AA seqDB search
MNAKPLSIPEVILLTPRVFGDDRGFFYESFNAQAFTKATGVATVFVQDNHSCSQRGVLRG
LHYQLPPYAQGKLVRVVHGEVFDVAVDIRRYSSTFGKWVGTLLSAENKRQLWIPPGFAHG
FITLSDRAEFLYKTTAYYAPVAERCIRWNDLDIGIDWPYSEAPFLSKKDKLGTSLVLAEG
FESEF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaagccgctttcgatccctgaggtcatcttgttgaccccccgtgtcttcggt
gatgaccggggctttttttacgaaagcttcaatgctcaagctttcacaaaggcaactggc
gttgccacagtttttgtgcaggacaatcattcgtgttctcagcggggtgtgttgaggggc
cttcattaccaacttcctccgtatgcgcagggcaaactcgtccgtgtcgtgcatggtgag
gtctttgatgttgccgtagacatcaggagatattcatcgactttcgggaagtgggtaggg
acgttgctgtcggctgagaacaagcgtcaattatggatcccgccaggattcgcccacgga
ttcatcacgttgagtgatcgcgctgagtttctttacaaaacaacagcctactatgcacct
gtagcggaacgttgcattagatggaacgatttggatattggcattgattggccatattcg
gaagcacccttcctttcaaagaaagacaagcttggaacgtcgcttgttttagctgaaggc
tttgaaagtgaattttag

DBGET integrated database retrieval system