KEGG   Desulfomicrobium baculatum: Dbac_2818Help
Entry
Dbac_2818         CDS       T00963                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dba  Desulfomicrobium baculatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dbac_2818
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dbac_2818
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dbac_2818
Enzymes [BR:dba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dbac_2818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3195230..3196000
Genome map
AA seq 256 aa AA seqDB search
MENNIDRALANAASIQLMTHVVAGYPNLDVNADLIRLMARRGVKLIEIQIPFTDPLADGP
TIMRANQAALDQGVTPRHCFELCAALSRELPEVAFLFMTYANIPFALGLETFMAKARQSG
ASGLILPDLSWDESDGDYAGAAREHGLHPVMVISPDTQSPRLDAILSRASGLLYTTLKVG
ITGAGAGIDQTGVDYVRSLKKKTGLPIAAGFGISSPDHVRMLDGLADVAVIGSHIINLMD
AQGLGAVDEFLAACGD
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatatcgaccgggcgctggcaaacgcggcaagcatccagctcatgacccat
gtggtggccgggtacccgaatctggacgtgaacgccgatctcatccggctcatggccagg
cggggggtgaaactcattgaaatccaaatccccttcaccgatccactggccgatggcccg
accatcatgcgcgccaaccaggccgcccttgatcagggcgtcacgccccgccactgcttc
gagctgtgcgcggccctttccagggaactgccggaggtggcgttcctgttcatgacctac
gccaacatcccgtttgccttggggcttgaaacgttcatggccaaggccaggcagagcggg
gccagcggcctgatcctgcccgacctgtcctgggacgagagcgacggcgactacgccggg
gccgcccgcgaacacggactgcacccggtcatggtcatttccccggacacgcaaagcccg
cgtctggacgccatcctgagccgcgcctcaggcctgttgtacacgacgctcaaagtcggc
atcaccggggccggagccggcatcgatcagaccggcgtggattatgtccgaagcctgaag
aaaaaaaccggcctgcccatcgccgccggtttcggcatctcaagccccgatcacgtccgc
atgctggacggcttggccgacgtggccgtgatcggcagccacatcatcaacctgatggat
gcacaggggctgggggccgtggatgaatttttggcggcgtgtggggattga

DBGET integrated database retrieval system