KEGG   Desulfomicrobium baculatum: Dbac_2818Help
Entry
Dbac_2818         CDS       T00963                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dba  Desulfomicrobium baculatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dba01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dba00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dba00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3195230..3196000
Genome map
AA seq 256 aa AA seqDB search
MENNIDRALANAASIQLMTHVVAGYPNLDVNADLIRLMARRGVKLIEIQIPFTDPLADGP
TIMRANQAALDQGVTPRHCFELCAALSRELPEVAFLFMTYANIPFALGLETFMAKARQSG
ASGLILPDLSWDESDGDYAGAAREHGLHPVMVISPDTQSPRLDAILSRASGLLYTTLKVG
ITGAGAGIDQTGVDYVRSLKKKTGLPIAAGFGISSPDHVRMLDGLADVAVIGSHIINLMD
AQGLGAVDEFLAACGD
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatatcgaccgggcgctggcaaacgcggcaagcatccagctcatgacccat
gtggtggccgggtacccgaatctggacgtgaacgccgatctcatccggctcatggccagg
cggggggtgaaactcattgaaatccaaatccccttcaccgatccactggccgatggcccg
accatcatgcgcgccaaccaggccgcccttgatcagggcgtcacgccccgccactgcttc
gagctgtgcgcggccctttccagggaactgccggaggtggcgttcctgttcatgacctac
gccaacatcccgtttgccttggggcttgaaacgttcatggccaaggccaggcagagcggg
gccagcggcctgatcctgcccgacctgtcctgggacgagagcgacggcgactacgccggg
gccgcccgcgaacacggactgcacccggtcatggtcatttccccggacacgcaaagcccg
cgtctggacgccatcctgagccgcgcctcaggcctgttgtacacgacgctcaaagtcggc
atcaccggggccggagccggcatcgatcagaccggcgtggattatgtccgaagcctgaag
aaaaaaaccggcctgcccatcgccgccggtttcggcatctcaagccccgatcacgtccgc
atgctggacggcttggccgacgtggccgtgatcggcagccacatcatcaacctgatggat
gcacaggggctgggggccgtggatgaatttttggcggcgtgtggggattga

DBGET integrated database retrieval system