KEGG   Desulfomicrobium baculatum: Dbac_2928Help
Entry
Dbac_2928         CDS       T00963                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dba  Desulfomicrobium baculatum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dba00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dba00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3313012..3314160)
Genome map
AA seq 382 aa AA seqDB search
MTSFGIFCRGVACMLLLTVVPGPLLAAEQTLLRDMIGQMLLVGFRGTTVDGASPILRDIR
EHNLGGVILFDRDVQLQSPERNIQSPEQVRVLTASLQANARVPLFVAVDQEGGRVRRFRE
DRGFAPGPSAKAMGQGSSDQTRLEGERTGKLLADLGVNLNFAPVADVDINPQSPAIGALE
RSFSADPDLVALHAHAFCRGLLAQGVLPCLKHFPGHGSASADSHRGLTDISNTWSAAELR
PYEMLIPLKASPLIMTGHLFLRQLDDAYPSTLSKAVLTGLLRQRLGFQGVIVSDDMQMRA
IADHYGQAEAILLAVEAGVDVLVFGNNLDYDPEIVPKAIDILVKAVEDGRLSVERIAASY
QRIQAAKQQFYTSFAWAPQVRP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatttggaattttttgtcggggtgttgcctgcatgctattgcttaccgtggtg
cctggcccgttgctcgcagcggagcagacgcttcttcgcgacatgatcggccagatgctt
ctggtcggttttcgcggaacaaccgttgacggggcctccccgatcctgcgcgacatacgg
gagcacaatcttgggggcgtgatcctctttgatcgcgatgtgcagttgcaaagtccggaa
cgcaacatccagagcccggagcaggtccgggttctgaccgcgagtctgcaggcaaacgct
cgggtcccgctctttgtcgccgtggatcaggaaggcggacgggtgcgtcgcttccgggag
gatcggggttttgcgcccggtccttcggccaaggccatggggcagggcagttcggaccag
acccggcttgagggcgagcggaccggaaagctgctggcggaccttggcgtgaatctcaat
ttcgcacccgtggcggatgtggacattaatccgcaaagtccggccattggtgccctggaa
cgcagtttctccgccgatccggacctcgtcgcgctccatgcccatgctttctgccgaggg
ctgctggcgcagggcgtgctgccctgtctcaagcattttcccgggcatggcagcgcctcg
gcggactcgcatcgtggactgaccgacatcagcaacacctggagcgctgcggagctgcgt
ccctacgagatgctgataccgctgaaggccagcccgctgatcatgactgggcatctcttc
ctgcgccagcttgatgatgcctaccccagcaccctgtccaaggctgtgctgacggggctt
ttgcggcagcgtctgggttttcagggcgtcatcgtctccgacgacatgcagatgcgcgcc
atcgccgaccattatggccaggccgaagcgattcttctggctgtcgaggccggggtggat
gtgctggttttcggcaacaacctggattacgatcccgagatcgtacccaaagccattgat
attctggtcaaggccgtggaggacgggcgcctgtccgtcgaaagaattgcagcctcgtat
cagcgcattcaggccgccaagcagcagttctacaccagttttgcctgggcgccgcaggtg
cggccatga

DBGET integrated database retrieval system