KEGG   Desulfomicrobium baculatum: Dbac_2959Help
Entry
Dbac_2959         CDS       T00963                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dba  Desulfomicrobium baculatum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dbac_2959
Enzymes [BR:dba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dbac_2959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3346397..3347905)
Genome map
AA seq 502 aa AA seqDB search
MNLARRCGVLLHVSSLPSRHGIGDFGPCAHEYIDFLAAGGQGVWQMLPLAPINAGAGNSP
YSSYSAFAGNTLFISPELLVRQGVLRPRDVEPAPDFPQDRVDYAAAAAWRERILEQAFDN
AFPGLRADVRFDAFCRKASFWLDDYCLFAALKREQRGAPWLSWPRGLRLREPDALEQARE
RLGYDILRERYFQYLFSLHWENLRDYAATRGVALLGDVPIYVSLDSSDVWAHRELFELDR
EGLPIYCAGAPPDYFSKTGQMWGNPVYDWAFQEKDGFSWWAKRLRHESERFDMLRLDHFR
GFCGFWQVPACEPTAENGLWIKGPGAAFFSAMKERVPGLSILAEDLGVITEDVVTLMREF
EFPGMKILQFAFSEEMGKNAYIPHNFPVQSAVYTGTHDNNTVRGWFSDELDDQGRGRLRD
YAGRHVSAEDAADVMIRLALGSVAALCIIPMQDYLNLDATGRMNMPGVAGGNWGWRMQPG
MATRDVAARMRFQAWIYGRVAE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgcgcgtagatgcggggtgctgctgcacgtctcctcgctgccaagtcggcac
gggattggcgattttggtccgtgcgcccacgagtacatagattttctggccgcaggcggg
cagggggtgtggcagatgctcccccttgcgcccatcaacgcaggagcgggcaattctcca
tacagcagctattcggcctttgccgggaacacgctttttatcagcccggagctgctggtc
cgtcaaggagtgctcaggccgagggacgtggagcctgcgcccgattttccccaggaccgg
gtggactacgccgcggctgccgcatggcgggagagaattctggaacaggccttcgacaat
gcatttcccggcctgcgagcggacgtacgttttgacgccttctgccgcaaggccagcttc
tggcttgatgactactgtttgttcgcggccttgaagcgcgagcagagaggagcgccatgg
ctgagctggccgcgcgggctgcgtctgcgggaacccgacgctttggagcaggcccgcgaa
cgcctggggtacgacatcctgcgggaacggtattttcagtatcttttcagcctgcactgg
gagaatctgcgcgattatgcggccacgcgcggggtggccctgctcggggatgtgccgatc
tatgtcagtctcgacagcagtgatgtctgggcgcaccgggagctgttcgagctcgaccgc
gagggcttgccgatctattgcgccggagcaccgccggattatttttccaagaccggccag
atgtggggtaatcctgtctatgactgggctttccaggaaaaggacggcttttcgtggtgg
gccaagcggctgcggcacgagagcgagcggttcgacatgctccggctcgatcattttcgc
ggtttttgcgggttctggcaggtgccggcctgtgagccgacagcggaaaacggactctgg
atcaaagggccgggagccgcgtttttcagcgcaatgaaggagcgcgttccgggtctgtcc
attctggccgaggatctgggagtcattacggaggacgtcgttacgctcatgcgcgagttt
gaatttccgggcatgaagattttgcaattcgcattttcggaagagatggggaagaacgcc
tacatcccgcacaacttcccggtgcaaagcgcggtctataccggcacgcatgacaacaac
accgtgcggggctggttttcagacgagctcgatgaccagggacgggggcgtttgcgtgac
tacgcaggccggcacgtttcggcagaggacgcggccgacgtcatgattcggctggcgctt
ggcagcgtggccgctctgtgcatcattcccatgcaggattatttgaatttggatgcaacg
ggacggatgaacatgccgggggttgcgggaggcaattggggatggcgcatgcagccgggc
atggccaccagggatgtggcggcacgaatgcgtttccaggcctggatttacggacgcgtt
gcggagtga

DBGET integrated database retrieval system