KEGG   Desulfomicrobium baculatum: Dbac_3067Help
Entry
Dbac_3067         CDS       T00963                                 

Definition
heavy metal translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
dba  Desulfomicrobium baculatum
Brite
Enzymes [BR:dba01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     Dbac_3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3469928..3472402
Genome map
AA seq 824 aa AA seqDB search
MNSTSRSIRLPVGGMHCAACSTRIEKVVGAMPGVEQIVVNLATEEMDLRFNPQDAPLDTI
LEQVRELGFSVEAPTEQSVLELKIGGMHCAACSSRIERVTGRIEGVTEASVNLGAESGRF
VFDPALVSQRALRQAIHDAGFTTSIPQKERAGDEEERINARLAEKKKVVLWSMAFALPLL
VLSMGHMWGMPLPHWLDPMHAPGAFALAQLLLTLPVVWSGRSFYLIGFPALARRAPNMDS
LVAVGTGAALVYSLWNTVEIWLGVDAQARAMDLYYESAAVLIAMISLGKFFEARSVSRTT
GAVRALMALAPDTATLVDGENERKIPVEEIEPGDLLRIRPGERLPVDGEVAEGQSHVDES
MLTGEPLPVRRGPGGRVYGGTLNTTGAFVMRASLVGEDTMLARIVRLVRDAQGSKAPIAS
LADTISYYFVPVVMVLALVSGLAWYFFSDEPFVFALRIAISVLVIACPCAMGLATPTSIM
VGTGRGAQLGVLIKSGRALQRAGELGTLVFDKTGTLTVGKPVLSEVWVDPAAGIDKESLL
RLSASIEAQSEHPLARAVVLAVQGPLPKASDFLSVPGQGVTAVVEGRAVAIGNERLMQAE
NLNLEEAKAVRERMEENGATVVHVAVDGRLAGLLAVSDQLRPEAKGALQRLRDLGMEIVL
LTGDSERSAQAVARQLGIGRVIAGVLPDRKAEVIIDLQKEGRAVGMVGDGINDAPALARA
DLGVAMGGGMDVALESGDVVLMREDLTGVLTALSLSRAVMRNIRQNLFWAFAFNTIGLPV
AAGLLHIFGGPTMSPMLAGTAMAMSSVLVVSNALRLRFFISPHT
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgacatcacgttcaatacgtttacccgtcggcggaatgcactgcgcggcctgt
tcgacccgcatcgaaaaagtggtcggggccatgcccggggtggagcagatcgtggtcaac
ctggccacggaagagatggacctgcgcttcaatcctcaagacgcgcccttggacacgata
ttggagcaggtacgggagctgggtttttccgttgaggcgccgacagaacaaagcgtgctt
gagctcaagatcggcggcatgcactgcgcggcctgctcttcgcgcattgagcgtgtcacc
ggccgcattgagggcgtgacggaggccagcgtcaacctcggcgcggaaagcggccgtttc
gtctttgacccggccctggtctcgcagcgcgccctgcgccaggccatccacgacgcaggc
ttcaccacgagcatcccgcagaaggagcgtgccggggacgaggaagagcgcatcaacgcc
cgtctggcggagaaaaaaaaggtcgtgctctggtccatggcttttgccctgccgcttctg
gtactctccatgggccacatgtggggcatgcccctgccccactggctcgaccccatgcac
gcgcccggagccttcgccctggcccagctgctgctgaccctgcccgtggtctggagcggc
cgcagcttctacctgatcggattccccgccctggcccgccgcgccccgaacatggactcg
ctggtggccgtgggcacgggcgcggccctggtctattcgttgtggaacacggtggagatc
tggctgggcgtggacgcccaggcccgggccatggacctctactacgaatccgccgccgtg
ctcatcgccatgatctcgctgggcaaatttttcgaggcccgctccgtatcgagaaccacg
ggcgcggtacgggcgctcatggccctggctccggacacggccacgctggtggacggcgag
aacgagcgcaagatcccggtggaagagatcgaacccggcgacctcttgcgcatccgcccc
ggcgaacgcctgcccgtggacggcgaagtggcggaggggcagagccatgtggatgaatcc
atgctcacgggcgagccgctgccggtacggcgcggtcccggaggccgcgtttacggcggc
acgctgaacaccacgggcgcgttcgtcatgcgcgcctccctcgtcggcgaggataccatg
ctggcccgcatcgtacgcctggtgcgcgacgcccagggctccaaggcccccatcgccagt
ctggccgacaccatcagctattatttcgtgcccgtggtcatggtcctggccctggtttcg
ggcctggcctggtactttttcagcgacgagccctttgtcttcgccctgcgcatcgccatc
tccgtgctggtcatcgcctgcccctgcgccatgggcctggccaccccgacctccatcatg
gtcggcacgggacgcggcgcgcagctgggcgttttgatcaagtccggccgcgccctgcag
cgggccggggagctcggcaccctggtcttcgacaagacaggaaccctgaccgtgggcaag
ccggtgctaagcgaagtctgggtcgatccggcggcagggatcgacaaggagtccttgttg
cgcctgtccgcatccatcgaggcccagtccgagcaccccctggcccgggccgtggtcctc
gccgtgcagggccccctgcccaaggcttcggatttcctgtccgtgcctggccagggcgtg
accgccgtggtcgaaggccgcgccgtcgccataggcaacgaacggctgatgcaggccgaa
aacctgaatctggaagaggccaaggccgtgcgcgaacgcatggaggagaacggggccacc
gtggtgcatgtggcggtggacgggcgtctggcgggcctgttggccgtaagcgaccagctg
cgacccgaagcgaagggggccctgcagcggctgcgcgatctgggcatggagattgtgctc
ctgaccggagattccgagcgctcggcgcaggccgtggcccgtcagctcggcatcgggagg
gtcatcgccggggtgctgccggaccgcaaggccgaggtgatcatcgatcttcagaaggag
ggccgcgccgtgggcatggtcggagacgggatcaacgacgccccggccctggcccgggcc
gatctgggcgtggccatgggcggcggcatggacgtagccctggaatcgggggacgtggtg
ctcatgcgggaagatctcaccggcgtgctcacggcgctgtccctgagccgggcggtgatg
cgcaacatccgccagaatctattctgggccttcgccttcaacaccatcggactccctgtc
gcggctgggctcctgcacatcttcggcggaccgaccatgagccccatgctcgcaggcacg
gccatggccatgagctcggtcctggtggtttcaaacgccttgcggctgcgtttttttatt
tctcctcatacataa

DBGET integrated database retrieval system