KEGG   Desulfomicrobium baculatum: Dbac_3375Help
Entry
Dbac_3375         CDS       T00963                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dba  Desulfomicrobium baculatum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dbac_3375
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dbac_3375
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dbac_3375
Enzymes [BR:dba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dbac_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3808608..3810056
Genome map
AA seq 482 aa AA seqDB search
MREANVFPTYRGEMEYVCLGCQARYPIDELHYTCPSCKGVFLLEDTRFPELEKTPGSAWR
DIFDLRAATKNPALRGIFRFYELMAPVVAEEHIVYLGEGNTPVTRSSTALERLVGQSMAF
KNDGQNPSASFKDRGMACAYSYLRHLVAKHGWDNVLTICASTGDTSAAAALYAAYVGEPL
TSVVLLPQGKVTAQQLSQPLGSGAKVLEIPGVFDDCMKVVEYLADHYRVALLNSKNAWRI
LGQESYAFEVAQWYDWDLRGKVIFVPIGNAGNITAIMSGFLKLLRLGIIETLPRIIGVQS
EHADPVFRYYDQDPGHRRFEAVKVRPSVAQAAMIGNPVSFPRVAFLAEQYQKLGGAGSFA
VVQVSEQRIIESMLLANRHGHIACTQGGECLAGLFKAKELGLMEEGELAVLDATAHALKF
AGFQDMYFHDGFGPEFEITPDRKLANVPRLVIDQQDKERLSEDAFTVQAAQNVVGILGLD
KK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagccaacgttttccccacatacagaggggagatggaatatgtctgcctcggc
tgccaggccagataccccattgacgaactgcattacacctgccccagctgcaagggtgtt
tttctgctggaggatacccgctttccagagttggaaaaaacacccgggtccgcatggcgc
gatatcttcgatttgcgggcggcgacgaaaaatcctgccctgcgcggcatctttcgtttt
tacgagctgatggcccctgtcgtggccgaggagcacattgtctatctgggtgagggcaac
acccctgtgacccgctcctcgaccgctctggagcgcctagtgggccaatccatggccttc
aagaatgacggccagaatccgtccgcgtcattcaaggatcgcggcatggcgtgcgcctat
tcgtacctgcgccatctggttgccaagcatgggtgggacaatgtgctgaccatctgcgcc
tccacgggcgacacttcggccgcggcggcactctacgccgcgtatgttggcgagcccctg
acctcggtcgtgctgctgccccagggcaaggtcactgcgcagcaactgtcccagcctctg
ggcagtggggcgaaagtgctcgaaattcccggtgttttcgatgactgcatgaaggtggtc
gaatatctggccgatcattaccgtgtggcgctcctgaattccaagaacgcctggcgcata
ctcgggcaggagagctatgcctttgaggtggcacagtggtatgattgggatctgcgcggt
aaggttattttcgtgcccatcggcaatgccggaaacatcacggccatcatgagcggcttc
ctgaagctgctgcggcttgggatcatcgagaccctgccgcgcatcatcggcgtgcagtcc
gaacacgccgaccccgttttcaggtactatgaccaggaccccggccatcgccggttcgag
gccgtgaaggtccggccgtcagtggcccaggccgcgatgatcggcaatcccgtatccttt
ccgagggtcgcttttctggcggagcagtatcagaagctgggcggcgccggatctttcgcg
gtggtgcaggtcagcgaacagcgcatcatcgagtccatgctgctggccaacaggcacggc
catattgcctgcacccagggcggggaatgcctggccggactgttcaaggccaaagagctt
gggctcatggaagagggcgaacttgcggtgctcgacgccaccgcccacgctttgaagttc
gctggattccaggacatgtatttccatgacgggtttggtcccgaatttgaaatcacgccg
gacaggaaactggccaacgtgccgcgtctggtcattgatcagcaggacaaagagcgcctg
tccgaggatgcgtttacggttcaggccgcacaaaatgtggtcggcattctggggctggat
aaaaaatga

DBGET integrated database retrieval system