KEGG   Desulfomicrobium baculatum: Dbac_3420Help
Entry
Dbac_3420         CDS       T00963                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dba  Desulfomicrobium baculatum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dbac_3420
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dbac_3420
Enzymes [BR:dba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dbac_3420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3858872..3860026
Genome map
AA seq 384 aa AA seqDB search
MELSTDWREQRRRILEKAKRVVIKIGSAVLTTEKGLDPRVVNRLADQIAGLHDRGLEIVL
VTSGAVAAGRCVLGADKAAGCMVHKQAASAVGQSRLMHSYDEAFAHYEKITAQVLLTKDD
LRSRERFLNARNTMCRLLDWKVIPIVNENDTVAVQELKFGDNDALSSMVANLVGADVIIN
LTSADGVFDDNPLENPDALFVPCIENISDLNLQSMCRGKTGAGTGGMLSKLMAARRAASI
GVPTLIVSGRQKHVLERVFDLEDLGSWIAPTQKMLSGRKFWLAYHLDPVGSIVVDDGAAR
ALTSKGKSLLAAGIAGVEGTFGMGALVRIVRLDGGAVGVGLTNFKAVELRKIQGLSSSEI
EKILGPCPHQEVVHRDNMVLDSSL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggaactatcgactgattggcgcgagcagcgccgccggattctggagaaggccaaacgg
gtcgtcatcaagattggcagcgccgtgttgaccacggaaaagggcctcgacccgcgcgtg
gtcaaccgcttggccgatcagatcgcggggctgcatgaccggggccttgagatcgtgctc
gtgacctccggggccgtggccgcagggcgctgcgtgctcggcgcggacaaggccgccggc
tgcatggtgcataagcaggccgcctcagccgtgggccagagccggctcatgcacagctat
gacgaggcgttcgcgcactacgagaagatcacggcgcaggtcctcttgaccaaggatgac
ctgcgcagccgcgagcgttttctgaacgcgcgcaacaccatgtgccgtctgctggactgg
aaggtcatccccatcgtcaacgagaacgataccgtggccgtgcaggagctcaaattcggc
gacaacgacgccctttcgtccatggtcgccaatctggtcggggccgatgtgatcatcaat
ctgacctccgccgatggcgtctttgacgacaatcccctggaaaatcccgacgccctcttt
gtgccctgcatcgaaaacatttccgatctcaatttgcagtccatgtgccggggcaagacc
ggggccggaaccggcgggatgcttagcaagctcatggccgcccgccgcgccgcgagcatc
ggcgtgccgacgctgatcgtctcggggcggcagaagcacgtgctggagcgcgtgttcgat
ctggaagacctgggctcctggattgcgccgacgcagaagatgctctcgggccgcaagttc
tggctggcctatcacctggacccggtcggcagcatcgtcgtcgatgatggcgcggctcgc
gctctgacaagcaagggcaagagcctcttggctgcgggtatcgccggtgtggaaggcact
ttcggcatgggcgctctggtccggatcgtgcgcctcgatggcggcgccgtgggcgtgggg
ctgacgaacttcaaggccgtggaactgcgcaagatccagggtttgagcagttccgaaatc
gaaaagatcctggggccctgcccgcatcaggaggttgtgcatcgcgacaatatggtgctc
gatagttcgctctga

DBGET integrated database retrieval system