KEGG   Desulfomicrobium baculatum: Dbac_3492Help
Entry
Dbac_3492         CDS       T00963                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dba  Desulfomicrobium baculatum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dbac_3492
Enzymes [BR:dba01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dbac_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3940033..3940629
Genome map
AA seq 198 aa AA seqDB search
MIAYLEGTVLRRDEESCVLLTAGGVGYQLHLTSDGLAALPGAGDTARLFVHTLVREDALT
LFAFSSWEERQAFVTLLGAPKLGPKTALAMLGCYSPAELAACIAKEDVAALSRVPGIGAK
TAKRLLLDLKDKLVSSPSLLPGRTAPAPTASADCAAALVSLGYGRHEVDEVVRVVFEKEP
DLDAGSAIRQALKIFASK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctatcttgaaggaacggtcctgcgccgcgatgaagagtcctgtgtcctgctc
accgcagggggcgtgggctatcagctccacttgacctcggacgggttggccgccctgccc
ggcgccggtgatacggcccggcttttcgtccataccctggtccgcgaggacgccttgacc
ctcttcgctttttcctcctgggaagagcggcaggccttcgtgaccctgctcggcgcgccc
aagctcggtcccaagacggccctggccatgcttggatgctattccccggcggaacttgca
gcctgcatcgccaaggaagacgtggccgccctgagccgtgtgcccggaatcggcgccaag
acggccaaacggctgctcctggacctgaaggacaagcttgtttcttctccaagcctgctt
cccggccgcaccgctccggcgcccacggcttcggcggattgcgcggcggcgctcgtgtcc
ctgggatacgggcggcatgaagtggacgaggtggtgcgggtggtgttcgaaaaagagccc
gatctggacgcgggcagcgccatccggcaggctctgaagatttttgcttccaaatag

DBGET integrated database retrieval system