KEGG   Desulfarculus baarsii: Deba_0005Help
Entry
Deba_0005         CDS       T01284                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
dbr  Desulfarculus baarsii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Deba_0005
   00240 Pyrimidine metabolism
    Deba_0005
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Deba_0005
   03430 Mismatch repair
    Deba_0005
   03440 Homologous recombination
    Deba_0005
Enzymes [BR:dbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Deba_0005
DNA replication proteins [BR:dbr03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Deba_0005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4801..5238)
Genome map
AA seq 145 aa AA seqDB search
MELEFVNLKQCGRAPGEAVARLAAWHWRQGARVLILAADPRQAAGLDALLWTFDPASFVP
HALAGGADQADEPVLISQEPANLNHASVLIMTKPPASPQAVPPGFQRVIVLIPLEDGPDL
HACRDCFRLARDQGLNPAHATSLPL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagttcgtcaatctgaagcagtgcggccgcgcgcccggcgaggccgtggcc
cgcctggccgcctggcactggcggcaaggggcgcgggtgctgatcctggccgccgatccg
cggcaggccgccggcctggacgccctgctctggaccttcgacccggcctcgttcgtgccc
cacgccctggccggcggggccgatcaggccgacgaaccggtgctgatcagccaggagccg
gccaacctcaaccacgcctcggtgctgatcatgaccaaaccgccggcctcgccccaggcc
gtgccgcccggctttcaacgggtcatcgtcctgatccccctggaagacggccccgacctg
cacgcctgccgcgattgcttccgcctggcccgcgaccagggcctcaacccggcccacgcc
accagcctgccgctctag

DBGET integrated database retrieval system