KEGG   Desulfarculus baarsii: Deba_0052Help
Entry
Deba_0052         CDS       T01284                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dbr  Desulfarculus baarsii
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Deba_0052
Enzymes [BR:dbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Deba_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61797..62696
Genome map
AA seq 299 aa AA seqDB search
MSLDGPITSFSELPNPPEEAARAAIIPAPLEATVSYGHGTSLGPAAIIFASQQLELYDNV
VDCQVMDLGVITRPAVNVSPPLETALTRIEAAVGRELDAGRLPVLLGGEHTVTVAALRAL
VKRRGADFTVLSLDAHLDLRDSYEGSPYSHACAMRRALDLGLEVRHFGARSCSLAEMELI
RARGMEPLWAREVHNDPDWLQKAVAGLEGPVYLTLDVDGFDASVMPATGTPEPGGLSWPQ
VTAWLEAVCARCPVIGLDVVELAPLMGMTAWDFTAAKLVHRALGLALLGGPKPSHGSER
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttggatggaccgatcacctctttttccgaactgcccaacccgcccgaggaggcc
gcccgggccgcgatcatccccgcgcccttggaggccacggtaagctacggccacggcacg
tccctgggcccggcggcgatcatcttcgccagccagcaactggagctttacgacaacgtg
gtcgattgccaggtcatggatctgggcgtgatcacccggccagcggtgaatgtttctccg
ccgctggagacggccttgacgcgcatcgaggcggcggtgggccgagagctggacgccggc
cgcctgccggtgttgttgggcggcgagcacaccgtgaccgtggccgccttgcgggccctg
gtcaaacgtcgtggggccgatttcacggtattgagcctggacgcccacctggatctgcgc
gacagctacgagggcagcccctattcccacgcctgcgccatgcgccgcgcgctggacctg
ggcctggaggtgcgccattttggcgcgcgcagttgctcgctggccgagatggagctgatc
cgggccaggggcatggagccactgtgggcccgtgaggtgcacaacgacccggactggctg
caaaaggccgtggccggtctggaaggcccggtttatctgacgctggacgtggatggcttc
gacgcctcggtgatgccggccactggcacgcccgagcccggcggcctgagttggccccag
gtcaccgcttggctggaggccgtctgcgcccgttgcccggtgatcggcctggacgtggtg
gagctggccccgctgatgggcatgaccgcctgggacttcaccgcggccaagctggtccat
cgcgccctgggcctggccctgctgggcgggccaaagccaagtcacggaagcgagagatga

DBGET integrated database retrieval system