KEGG   Desulfarculus baarsii: Deba_0086Help
Entry
Deba_0086         CDS       T01284                                 

Definition
3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
dbr  Desulfarculus baarsii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deba_0086
   01212 Fatty acid metabolism
    Deba_0086
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Deba_0086
   00650 Butanoate metabolism
    Deba_0086
  Lipid metabolism
   00071 Fatty acid degradation
    Deba_0086
   01040 Biosynthesis of unsaturated fatty acids
    Deba_0086
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Deba_0086
   00310 Lysine degradation
    Deba_0086
   00380 Tryptophan metabolism
    Deba_0086
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Deba_0086
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Deba_0086
   00281 Geraniol degradation
    Deba_0086
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Deba_0086
Enzymes [BR:dbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Deba_0086
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Deba_0086
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Deba_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91960..94089
Genome map
AA seq 709 aa AA seqDB search
MKTDFKTVQVAIEDGVAVFTMNNPPVNQLSDYFIKDLVAAFEEAWKDDQVYAIVLTGEGK
NFVAGADITQLQKMKNRDEAFGLVMEGHKFYNAIELSPKPVIAAINGNCLGGGLELAMCC
HYRVAVKGVSLGLPEVSLGLLPGGGGTQRLPRIIGLPNAAQMMTTGKPIKAEVAFVRGLV
DEVCAPDKLLKKAFGAAKMFKARMYNQKVRTARNTFYRLPSFNEKLHFMNYIRAMVGAQS
KGYIAPGKILDCLDKGLSADFEADLKVEANGFADLVTSAVAKNLIGMFLNTRSAGRLPRI
KDLKPAKPMKVAQLGGGVMGCGIVHLLLANGFECVLWDINDAALAKGVESVKKTFAFMIK
KKKMKPADLDKLLAEKLTTTTKLEDLGDVDLVIEAVLENMKVKQEIWLTLEKTCRPDVIF
GTNTSALPITEMASVLKDPGRMIGLHFFNPAERMQLLEIICAQQTSDQTLATSVDFGRRI
KKVPIVVNDGPGFYVSRQLGGLMGGSVFLVADGVSGEAIEKAMMNFGMPMGPATLADLTG
IDINYHVNQTFARELGDRYTVHPLTEAIYNLGDYGRKTGRGYMDYTSGKPVPNPRLQQVV
ADYLKANNVAPKDMPEQEIIDAMLGLAINEAALMIEQGICDRPADMDLAMIYGTGFPPYR
GGILRYADTWGLKNVYETLVKLEGRYGKRFAPAKLIKDMAEKGETFYKE
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgatttcaaaaccgtgcaagtcgcgatcgaagacggcgtggcggttttcacc
atgaacaacccgccggtcaaccagttgtccgactatttcatcaaggatctggtggcggcc
ttcgaggaggcctggaaggacgatcaggtctacgccatcgtcctgaccggcgagggcaag
aacttcgtcgccggcgccgacatcacccagttgcagaagatgaaaaaccgtgacgaggcc
tttggcctggtcatggagggtcacaagttctacaacgccatcgagctttcgcccaagccg
gtgatcgccgccatcaacggcaactgcctgggcggcggcctggagctggccatgtgctgc
cactaccgcgtggcggtcaagggcgtcagcctgggcctgcccgaggtcagcctgggcctg
ctgcccggcggcggcggcacccagcgcctgccgcgcatcatcggcctgcccaacgcggcc
cagatgatgaccacgggcaagcccatcaaggccgaggtcgccttcgtgcgtggcctggtc
gacgaggtctgcgcccccgacaagctgctgaaaaaggccttcggcgcggccaagatgttc
aaggcgcgcatgtataaccaaaaagtgcgcaccgcccgcaacaccttctatcgcctgccc
agcttcaacgaaaagctccacttcatgaactacatccgggccatggtcggggcccagtcc
aagggctacatcgccccgggcaagatcctcgactgcctggacaagggcctgagcgccgac
ttcgaggccgacctcaaggtcgaggccaacggcttcgccgacctggtcacctcggcggtg
gccaaaaatctcatcggcatgttcctaaacacccgctcggccggccgcctgccgcgcatc
aaggacttgaagccggccaaacccatgaaggtggcccagttgggcggcggcgtgatgggc
tgcggcatcgtgcatctgctgttggccaacggcttcgagtgcgtgctgtgggacatcaat
gacgcggccctggccaagggcgtcgagtcggtcaagaagaccttcgccttcatgatcaaa
aagaagaagatgaagccggccgacctggacaagctgctggccgagaaactgaccaccacc
accaagctcgaagacctgggcgacgtggacctggtcatcgaggccgtgctggagaacatg
aaggtcaagcaggagatctggctgaccctggaaaagacctgccggcccgacgtcatcttc
ggcaccaacacctcggccctgcccatcaccgagatggccagcgtgctcaaggatcccggc
cggatgatcggcctgcacttcttcaacccggccgagcgcatgcagctcctggagatcatc
tgcgcccagcagacctccgaccagaccctggccaccagcgtggactttggccgacgcatc
aaaaaggtgcccatcgtggtcaacgacggcccgggcttctatgtttcgcgccagctgggc
ggcctgatgggcggctcggtgttcctggtggccgacggcgtcagcggcgaggccatcgaa
aaggccatgatgaactttggcatgcccatgggcccggccaccctggccgacctgaccggc
atcgacatcaactaccacgtcaatcagaccttcgcccgcgagttgggtgatcgttacacc
gtccaccccctgaccgaggccatctacaacctgggcgactacggccgcaagaccggccgg
ggctacatggactacacctccggcaagcccgtgcccaacccgcgcctgcagcaggtggtg
gccgactacctcaaggccaacaacgtcgcgcccaaggacatgcccgagcaggagatcatc
gacgccatgctgggcctggccatcaacgaggccgcgctgatgatcgagcaaggcatctgc
gaccgcccggccgacatggacctggccatgatctacggcacgggcttcccgccctaccgc
ggcggcatcttgcgctacgccgacacctggggcctcaaaaacgtttacgagacgctggtc
aagctggaaggtcgctacggcaaacgcttcgctccggccaaactgatcaaggacatggcc
gaaaagggtgaaaccttctacaaggaataa

DBGET integrated database retrieval system