KEGG   Desulfarculus baarsii: Deba_0147Help
Entry
Deba_0147         CDS       T01284                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
dbr  Desulfarculus baarsii
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dbr00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161729..162793
Genome map
AA seq 354 aa AA seqDB search
MNHPALFDAFPALAQRLARAPLLEGPTPLQPLAQASQSLGVEVWVKRDDLSSTVYGGNKP
RKLEFILGRALAEGRRELVTMGAMGTNHGLATTIHGQRLGLTTSLELFPQPLTSVVLRNI
KLFQHFGARINLSPTMERAFLRFRYWQRLRRPGACFIPAGGSSPLGAVGYVSAGLELAGQ
LAAGQGPRPQAVFVAAGTLGSQAGLRLGLLLAGQDIPVIGVAVVPLAAANAKAALNLARR
TLALLRAADPSVPELTLAAEDFVIDPGQLGPGYGQPTPAALAAMDLLSRQEGLSLEPTYT
AKAFAGLCAWAQERPGQGPLLFWHTYNSARLDHLADQVDPAGLPEALRKYFLAQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatccggcgttgttcgatgccttcccggccctggcccagcgcctggcccgcgcg
ccgctgctggaaggccccacgcccctgcaaccgctggcccaggccagccagagcctgggc
gtggaggtctgggtcaagcgcgacgacctcagttcgaccgtttatggcggcaacaagccg
cgcaagctggagttcattctgggccgggccctggccgagggccggcgcgagctggtgacg
atgggggccatgggcaccaaccacggcctggccacgacgatccacggccagcgcctgggc
ctgacgacgtcgctggagctttttccccagccgctgacatcggtggtgctacgcaacatc
aagctgttccaacatttcggggcccggatcaacctcagcccgaccatggagcgggcgttt
ttgcgttttcgctattggcaacgcctgcgccggccgggggcctgcttcatcccggcgggc
ggctccagccccctgggcgcggtgggctacgtcagcgccgggttggagctggccggccaa
ctcgccgccggccaggggccccggccccaggccgtgttcgtggccgccggcaccctgggc
agccaggccggcctgcgcctgggcctgctgctggcggggcaggacattccggtgatcggc
gtggcggtggtgcccctggcggcggccaacgccaaggcagcgttgaacctggctcggcga
actctggccctgctgcgcgcggccgacccctccgtgcccgaactgacgctggcggccgag
gatttcgtcatcgaccccggccagcttggccccggctacggccagcccacgccggcggcg
ctggcggccatggaccttttgtcccgccaggagggcctgagcctggagcccacctacacg
gccaaggccttcgccggcctgtgcgcctgggcccaggagcggcccggccagggtccgctg
ctattttggcacacctacaactcggcccggctggaccatctggccgaccaggtcgatccg
gccggcctgcccgaagccctgcgcaagtacttcctggcccaatag

DBGET integrated database retrieval system