KEGG   Desulfarculus baarsii: Deba_0300Help
Entry
Deba_0300         CDS       T01284                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deba_0300
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deba_0300
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deba_0300
Enzymes [BR:dbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deba_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(342207..343562)
Genome map
AA seq 451 aa AA seqDB search
MKPVKTLLSEQDMPKQWYNIQADLPTPLAPPYHPATMQIVTPEQMNVIFPMSLIEQEMSD
KRWWEIPDEVLQILALWRPTPLQRAYNLEKALGTPAKIYFKNESVSPAGSHKPNTSVPQA
YYNKKEGIKRIATETGAGQWGSAMSLATNMFGIECTVYMVRVSYDQKPYRKSMINTWGAE
IFASPSTQTESGRKILAEDPDSPGSLGLAISEAVEDAAGRADTNYALGSVLNHVCMHQTI
IGEEALRQFKAIGEKPDVVIGCIGGGSNFAGIAFPFLREKMAGMDVRVLAIEPASCPTVT
KGVYAYDYGDMAHMAPIVMMHTLGHTFMPPSIHAGGLRYHGMAPTVSRVVEDGLVEARAI
TQLECFESGVLFARTEGIIPAPESTHAIRGAVEEALIAKEEGKEKTILFNLSGHGHFDMS
SYDAYFAGKLHNYRYPQELVDEALKHLPKVG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggttaaaaccctactgtccgaacaggacatgcccaaacagtggtacaacatc
caggccgacctgcccacgcccctggctccgccctaccatccggcgaccatgcagatcgtc
acccccgagcagatgaacgtcatttttcccatgtcgctcatcgagcaagaaatgagtgac
aagcgttggtgggagattcccgacgaggtcttgcagatcctggccctgtggcggccgacc
cccttgcaacgggcctacaacctggaaaaggccctgggcacgccggccaagatctacttc
aagaacgagtccgtcagcccggccggctcgcacaagcccaacacctcggtgccccaggcc
tactataataagaaggaaggcatcaagcgcatcgccaccgagaccggcgccggccagtgg
ggcagcgccatgagcctggccaccaacatgtttggcatcgagtgcaccgtctacatggtg
cgcgtcagttacgaccagaaaccatatcgcaagtcgatgatcaacacctggggcgcggag
atcttcgccagccccagcactcagaccgagtccggccgcaagattctggccgaagacccc
gacagccccggctccctgggcctggccatcagcgaagccgtggaggacgccgccggccgc
gccgacaccaactacgccctgggctcggtgctcaaccacgtctgcatgcaccagaccatc
atcggcgaagaggccctgcgtcagttcaaggccatcggcgagaaacccgacgtggtcatt
ggctgcatcggcggcggctccaacttcgccggcatcgccttccccttcctgcgcgaaaaa
atggccggcatggacgtgcgcgtcctggccatcgagccggccagttgccccaccgtgacc
aagggcgtctacgcctatgattacggcgacatggcccatatggcccccatcgtgatgatg
cacaccctgggccacaccttcatgccgcccagcatccacgccggcggcctgcgctaccac
ggcatggcccccaccgtcagccgcgtggtcgaggacggcctggtcgaggcccgggccatc
acccagctggagtgttttgaatcgggcgtgctctttgcccgcaccgagggcatcatcccc
gcccccgagtccacccacgccatccgcggcgcggtggaggaagcgctcatcgccaaggaa
gagggcaaggaaaaaacgatcttgttcaacctctccggccacggccacttcgacatgtcg
tcctacgacgcctactttgccggcaaactgcacaactatcgctatccgcaagagctggtc
gacgaggccctcaagcacctgcccaaggtcggctga

DBGET integrated database retrieval system