KEGG   Desulfarculus baarsii: Deba_0300Help
Entry
Deba_0300         CDS       T01284                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00260  Glycine, serine and threonine metabolism
dbr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
dbr01130  Biosynthesis of antibiotics
dbr01230  Biosynthesis of amino acids
Module
dbr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deba_0300
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deba_0300
Enzymes [BR:dbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deba_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADK83676
UniProt: E1QDP0
Position
complement(342207..343562)
Genome map
AA seq 451 aa AA seqDB search
MKPVKTLLSEQDMPKQWYNIQADLPTPLAPPYHPATMQIVTPEQMNVIFPMSLIEQEMSD
KRWWEIPDEVLQILALWRPTPLQRAYNLEKALGTPAKIYFKNESVSPAGSHKPNTSVPQA
YYNKKEGIKRIATETGAGQWGSAMSLATNMFGIECTVYMVRVSYDQKPYRKSMINTWGAE
IFASPSTQTESGRKILAEDPDSPGSLGLAISEAVEDAAGRADTNYALGSVLNHVCMHQTI
IGEEALRQFKAIGEKPDVVIGCIGGGSNFAGIAFPFLREKMAGMDVRVLAIEPASCPTVT
KGVYAYDYGDMAHMAPIVMMHTLGHTFMPPSIHAGGLRYHGMAPTVSRVVEDGLVEARAI
TQLECFESGVLFARTEGIIPAPESTHAIRGAVEEALIAKEEGKEKTILFNLSGHGHFDMS
SYDAYFAGKLHNYRYPQELVDEALKHLPKVG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggttaaaaccctactgtccgaacaggacatgcccaaacagtggtacaacatc
caggccgacctgcccacgcccctggctccgccctaccatccggcgaccatgcagatcgtc
acccccgagcagatgaacgtcatttttcccatgtcgctcatcgagcaagaaatgagtgac
aagcgttggtgggagattcccgacgaggtcttgcagatcctggccctgtggcggccgacc
cccttgcaacgggcctacaacctggaaaaggccctgggcacgccggccaagatctacttc
aagaacgagtccgtcagcccggccggctcgcacaagcccaacacctcggtgccccaggcc
tactataataagaaggaaggcatcaagcgcatcgccaccgagaccggcgccggccagtgg
ggcagcgccatgagcctggccaccaacatgtttggcatcgagtgcaccgtctacatggtg
cgcgtcagttacgaccagaaaccatatcgcaagtcgatgatcaacacctggggcgcggag
atcttcgccagccccagcactcagaccgagtccggccgcaagattctggccgaagacccc
gacagccccggctccctgggcctggccatcagcgaagccgtggaggacgccgccggccgc
gccgacaccaactacgccctgggctcggtgctcaaccacgtctgcatgcaccagaccatc
atcggcgaagaggccctgcgtcagttcaaggccatcggcgagaaacccgacgtggtcatt
ggctgcatcggcggcggctccaacttcgccggcatcgccttccccttcctgcgcgaaaaa
atggccggcatggacgtgcgcgtcctggccatcgagccggccagttgccccaccgtgacc
aagggcgtctacgcctatgattacggcgacatggcccatatggcccccatcgtgatgatg
cacaccctgggccacaccttcatgccgcccagcatccacgccggcggcctgcgctaccac
ggcatggcccccaccgtcagccgcgtggtcgaggacggcctggtcgaggcccgggccatc
acccagctggagtgttttgaatcgggcgtgctctttgcccgcaccgagggcatcatcccc
gcccccgagtccacccacgccatccgcggcgcggtggaggaagcgctcatcgccaaggaa
gagggcaaggaaaaaacgatcttgttcaacctctccggccacggccacttcgacatgtcg
tcctacgacgcctactttgccggcaaactgcacaactatcgctatccgcaagagctggtc
gacgaggccctcaagcacctgcccaaggtcggctga

DBGET integrated database retrieval system