KEGG   Desulfarculus baarsii: Deba_0344Help
Entry
Deba_0344         CDS       T01284                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dbr  Desulfarculus baarsii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deba_0344
Enzymes [BR:dbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Deba_0344
Exosome [BR:dbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deba_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387454..389343
Genome map
AA seq 629 aa AA seqDB search
MTRGLLTEFDLHLFNEGSHSRLHAKMGAHPVADGCHFAVWAPNARSVHVIGDFNDWDKSA
VAMELRGDSGIWEAFVKDARVGQRYKYHIRSRFKGYKVDKADPFGFYHEQSPATGSVIWP
RAYEWGDAAWLKRRAKANAHREPMSIYELHLGSWRLKPEEGNRWLTYRELAPLLVDYCRE
MAYTHVEFMPVMEHPFGGSWGYQITGYFAPTSRYGSPQDFMYLVDTLHQAGIGVVLDWAP
SHFPADEHGLKFFDGSHLFEHADPRQGHHPDWDSAIFNYGRNEVRSFLLSSAFFWLEFMH
ADALRVDAVASMIHLDYSRQPGQWIPNQYGGNENLEAISFLRRLNEDAYREIPGVQIIAE
ESTAWPMVSRPVYLGGLGFGFKWDMGWMNDVLKYMALDPVHRRYHQNDITFRSMYQYAEN
FVLPLSHDEVVHEKSTLIGKMPGDEWQKFANLRLLHGCMFAQPGKKLLFMGGELAQWREW
DYETSLDWHLLQYPPHQGVQRWVADLNRFYAAEPAMHRLDCEPGGFQWVDCADADQSVLT
FLRLDGQGRQVLAVFNFTPVPRHGYNIGVDVGGPWVEALNSDASQYGGSGLVNGPLVEAW
PGQVHGRPYHLSLTLSPLALMLLRPAGQQ
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcggcttgttgaccgaattcgacctgcatctgttcaacgagggcagccacagc
cgcctgcacgccaagatgggcgcgcatccggtggccgacggttgccacttcgcggtgtgg
gcgcccaacgcgcggtcggtccacgtcatcggcgatttcaacgactgggacaagtcggcc
gtggccatggaactgcggggcgactccgggatttgggaggcctttgtcaaggacgcgcgg
gtgggtcagcgctacaagtatcacatccgctcgcgcttcaagggctacaaggtcgacaag
gccgaccccttcggcttttatcacgaacaatcgccagcgacgggcagcgtgatctggccg
cgggcctacgagtggggcgacgccgcctggctcaagcgcagggccaaggccaacgcccac
cgcgagccgatgagcatctacgaactgcacctgggctcgtggcgcttgaagcccgaggag
ggcaatcgctggctgacctaccgcgagctggccccgctgctggtcgactattgccgcgaa
atggcctacacccacgtggaattcatgccggtgatggagcaccccttcggcggctcgtgg
ggctatcagatcaccggctatttcgcgccgaccagccgctatggctcgccgcaggatttc
atgtatctggtcgacacgctgcaccaggccggcatcggcgtggtcctggactgggccccc
agccactttccggccgacgaacacggcctgaagtttttcgacggctcgcatctgttcgaa
cacgccgacccgcgccaaggacatcaccccgattgggacagcgccatcttcaattatggc
cgcaacgaggtgcgctcgtttttgctctccagcgcctttttctggctggagttcatgcac
gccgacgccctgagggtggacgcggtggcctcgatgatccacctggactattcgcgccag
cccggccagtggatccccaaccaatacggcggcaacgaaaatctggaggccatatcgttt
ttgcgccggctcaacgaagacgcctatcgcgagatccccggcgtgcagatcatcgccgag
gagtcaaccgcctggcccatggtcagccgaccggtctatctgggcgggctgggctttggc
ttcaagtgggacatgggctggatgaacgacgtgctcaaatacatggccctggacccggtg
catcgccgctatcaccaaaacgacataacttttcgcagcatgtatcaatacgccgagaac
ttcgtgctgccgctgagtcacgacgaggtcgtccacgaaaaatcgaccctgatcggcaaa
atgcccggcgacgaatggcaaaagttcgccaatctgcgcctgctgcacggctgcatgttc
gcccagcccggcaagaagctgttgttcatgggcggcgaattggcccagtggcgcgagtgg
gactacgaaaccagcctggactggcatttgctgcaataccccccgcaccagggcgtgcaa
cgctgggtggccgacctcaatcgcttctacgccgccgagccggccatgcaccggctcgac
tgcgagcccggcggctttcagtgggtcgactgcgccgacgccgaccagagcgtcctcacg
ttcctgcgcctggacggccaaggccggcaggtgctggccgtgttcaacttcacgcccgtg
ccgcgccacggctacaacatcggcgtggacgtcggcggcccctgggtcgaggcgctcaac
agcgacgccagccaatacggcggttcgggcctggtcaacggcccgctggtcgaggcctgg
cccggccaggtccacggccggccatatcacttgagcctgaccctttcgccgctggcgctg
atgctcctgcgcccggccggccaacaatag

DBGET integrated database retrieval system