KEGG   Desulfarculus baarsii: Deba_0396Help
Entry
Deba_0396         CDS       T01284                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dbr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dbr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dbr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dbr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dbr00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:dbr00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451093..452016
Genome map
AA seq 307 aa AA seqDB search
MAAWLGVDIGGTNTRVGLVDDGGLIAARGFPTRPAAGVGPWAERLRQEAAELRGPDPLGV
GVACAGVLDIKTGVVLHALNLPLFNGQALVGLVSEALGLPAVLENDANLYALGEQSFGAG
QGHADLVCLTLGTGVGGGLIMDGRLVRGPLGSAGEIGHILVVGDGRLCGCGARGCLEAYA
SATGLRGMLVEALDAGRQTSLGREDSVAAMGAAALAGDELARELFAVAGMALGRAFADLI
CTLGLDLIILGGGVSRSWEMMRPAAHEELARRLRVLDPARVRVIAGALGDDAPVLGAAAL
ARQLLAR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctggttgggcgtggacatcggcgggaccaacacccgcgtgggtttggtggat
gacggcggcctgatcgccgcgcgtggctttcccacccggccggcggccggggtggggcct
tgggccgagcgcttgcggcaggaggccgccgagctgcgcgggcccgaccccctgggcgtg
ggcgtggcctgcgccggcgtgctggacatcaaaaccggcgtggttctgcacgcgctcaac
ctgcccttgttcaacggccaggccctggtggggctggtttcggaggcgctgggcctgccg
gcggtgctggaaaacgacgccaacctctacgccctgggcgaacagagctttggcgcgggc
cagggccacgccgacctggtctgcctgaccctgggcacgggcgtgggcggcgggctgatc
atggacggtcggctggtgcgcgggccgctgggctcggccggcgagatcggccacatcctg
gttgtcggtgacggccggctctgcggctgcggggcccggggctgcctggaggcctacgcc
tcggccacgggcctgcggggcatgctggtcgaggccctggacgccgggcgccagacgagc
ctgggccgcgaggactcggtggcggccatgggcgcggcggccctggccggcgacgagctg
gcgcgggagctgttcgccgtggccgggatggctttgggccgggcctttgccgatctgatt
tgcactttgggcctagacctgataatcctgggtggcggggtctcgcgaagttgggagatg
atgcgcccggcggcccacgaagaactggcccggcggctgcgcgtgcttgatccggcccgg
gtgcgggtgattgccggcgcgctgggcgacgacgcgccggtgctgggcgcggcggccctg
gcccgccaactacttgcgcgataa

DBGET integrated database retrieval system