KEGG   Desulfarculus baarsii: Deba_0633Help
Entry
Deba_0633         CDS       T01284                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deba_0633
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deba_0633
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Deba_0633
Enzymes [BR:dbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Deba_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(727518..728744)
Genome map
AA seq 408 aa AA seqDB search
MPNLQDSSKTPAPRSELPDAQGRFGRFGGRFVPETLMPAIHELEAAYAAAKVDPTFQAEL
DQLLQDYVGRQTPLYEAKRLSAHYGGARIFLKREDLAHTGSHKINNALGQALLARRMGKM
RIVAETGAGQHGVATATACALLGMECVVCMGEVDIERQALNVTRMKLLGASVKPVSCGAR
TLKDAVSDAMRYWVTNLADTHYIIGSVVGPHPYPAMARDFQAVIGRETRAQIVEKTGKLP
DVLLACVGGGSNAMGMFHPFIDEPGVRKIGVEAGGLGLDSGKHSACLGAGHDGVLHGALI
RLLQDAWGQVLEAHSIAAGLDYPGTGPEHCHFQAAGLAEYASVTDQEALEAFKLLSRLEG
IIPALESSHALAHLKHVAPRMPQDSIIVVCLSGRGDKDGSQTAALIEE
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacttgcaagattcatccaaaacgcccgcgccgcgctctgagctgcccgacgcg
caaggccgtttcggacgctttggcgggcgcttcgtgcccgaaacgctgatgccggccatc
catgaactggaggcggcctacgccgcggccaaggtcgatccgaccttccaggccgagttg
gaccagcttctgcaagactacgtcggccgccagaccccgctctacgaggccaagcgcctg
agcgcccattacggcggggcgcgcattttcctcaaacgcgaggatctggcccacaccggt
tcgcacaagatcaacaacgccctgggccaagccctgctggcccggcgcatgggcaagatg
cgcatcgtcgccgagaccggcgcgggccagcacggcgtggccacggccacggcctgcgcc
ctactgggcatggagtgcgtggtctgcatgggcgaggtggacatcgagcgccaggcccta
aacgtcacgcgcatgaagctcttgggcgccagcgtaaaacccgtcagttgcggggcgcgc
acgctaaaagacgccgtcagcgacgccatgcgttattgggtcaccaacctggccgacacc
cattacatcatcggctcggtggtgggcccccacccctacccggccatggcccgcgacttt
caagcggtgatcggccgcgagacccgcgcccagatcgtcgaaaaaacaggcaagctgccc
gatgtgctgctggcttgcgtgggcggcggctccaacgccatgggcatgttccaccccttc
atcgacgagcccggcgtgcgcaagatcggcgtggaggccggcggcctgggcctggacagc
ggcaagcattcggcctgcctcggcgccggccacgacggcgtgctgcacggggccttgatc
cgcctgctgcaagacgcctggggccaggtgctggaggcccactccatcgccgccggcctg
gattatcccggcaccggcccggagcactgccacttccaggccgccggcctggccgagtac
gcctcggtcaccgaccaggaggcgctggaggccttcaagctgctttcgcgcctggagggg
atcatccccgccctggagagcagccacgccctggcccacctgaaacacgtcgcgccgcgc
atgccccaggattccatcatcgtcgtgtgcctttcgggacgcggcgacaaggacggcagc
cagaccgccgccctgatcgaggagtag

DBGET integrated database retrieval system