KEGG   Desulfarculus baarsii: Deba_0708Help
Entry
Deba_0708         CDS       T01284                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deba_0708
   01230 Biosynthesis of amino acids
    Deba_0708
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deba_0708
   00030 Pentose phosphate pathway
    Deba_0708
   00051 Fructose and mannose metabolism
    Deba_0708
   00052 Galactose metabolism
    Deba_0708
  Energy metabolism
   00680 Methane metabolism
    Deba_0708
Enzymes [BR:dbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Deba_0708
Protein phosphatases and associated proteins [BR:dbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Deba_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(806354..807694)
Genome map
AA seq 446 aa AA seqDB search
MNEIKHTVRPEDTLIPALGPAKIVNPLTTMKAPEKRGFTFLDDDSARVLINPYSCEPDAD
GNLPASLEKAGPRRHIYFDPTKLKAAIVTCGGMCPGINSLVRSIVLQLYYMYGVRNIVGV
RYGLQGFIPSYGHDFIDLNPKTVQSIHGRGGSFLGMSRGPQPMDEIVDTLERQNIGLLFM
IGGDGTLHAAQSIHQEITNRGLKIGLVAIPKTIDNDICFVEMTFGFQTAVEAATRAILGA
HNEAEGAPNGLGLVKLMGRHSGFVAAHATLALTEVNFCLVPEVDFDLDGPNGLLQALNNR
MTARGHAVVVVAEGAGQKFFHTDHAEKDPSGNVRLGDIGTYLRDRFSAHFADQGVELNQK
YIDPSYMVRSVPANSGDRIFTGFLGHHAVHAGMSGRTGLLISLWNNHYVHAPIPLAICHR
KKIDPCGGLWRAVLESTGQPSLKNEA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagatcaaacacaccgtaaggcccgaggacaccctcatccccgccctgggcccg
gccaagatcgtcaaccccctgaccacaatgaaagcgcccgaaaagcgcggcttcaccttc
ctcgacgacgacagcgcccgcgttttgatcaacccctacagctgcgagccggacgccgat
ggcaacctgccggccagcctggaaaaagccgggccgcgccgccacatctacttcgacccc
accaagctcaaggcggccatcgtcacctgcggcggcatgtgcccgggcatcaactcgctg
gtgcgctcgatcgtcttgcagctttattatatgtatggcgtgcgcaacatcgtcggcgtg
cgctacggcttgcagggcttcatcccctcctacggccacgatttcatcgacctcaacccc
aagaccgtccagagcatccacggccggggcggctcttttctgggcatgagccgcggcccc
caacccatggacgagatcgtcgacaccctcgaacgccagaacatcggcctgctgttcatg
atcggcggcgacggcaccctgcacgcggcccagagcatccaccaggagatcaccaaccga
ggcctcaagatcggcctggtggccatccccaagaccatcgacaacgacatctgcttcgtc
gagatgaccttcggcttccagaccgccgtggaggcggccacccgggccatcctgggggcc
cacaacgaggccgagggcgcgcccaacggcctgggcctggtcaagctgatgggtcggcac
agcggcttcgtggccgcccacgccaccctggccctgaccgaggtcaacttctgcctggtg
cccgaggtcgacttcgacctggacggccccaacggcctgctacaggccctcaacaaccgc
atgaccgcccgaggccacgccgtggtggtggtggccgagggcgcgggccagaaatttttt
cacaccgaccacgccgaaaaagacccctccggcaacgtgcgcctgggcgacatcggcacc
tatctgcgcgaccgcttcagcgcccacttcgccgaccagggcgtcgagctcaaccaaaaa
tacatcgatccgtcctacatggtgcgctcggtgccggccaacagcggcgaccgcatcttc
accggctttctgggccaccacgccgtgcacgccggcatgagcggccgcacgggcctgctc
atctcgctgtggaacaaccactatgtccacgcgccgatcccgctggcgatctgccaccgc
aaaaagatcgacccctgtggcggcctgtggcgggcggtgctggagtccaccggtcagccc
agcctgaaaaacgaagcttga

DBGET integrated database retrieval system