KEGG   Desulfarculus baarsii: Deba_0725Help
Entry
Deba_0725         CDS       T01284                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dbr  Desulfarculus baarsii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dbr00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
825364..826227
Genome map
AA seq 287 aa AA seqDB search
MAKLTLAAPAKVNLSLRIIGRRADGYHELLTLMQPLSLADEVSVELRAGGVALACDDERL
IENNLMTRAAEAYFAALGAPPGVRLGLKKRIPVAAGLGGGSSDAAAVLLALNALHGGALD
PARLVALAAGLGADVAFFLAGQTALCSGVGEIVHPLPVFPLLHYVVVNPGFAVPTAWVYK
QFDLSWTSQNNCNKIICLPCAGHALCDILVNDLEGVTLTAYPQLVDVKRALAEAGAVGAL
MSGSGPSIFGVFADEGSATKAAHNLAARGQWWVEACRGVDACEGCCC
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagctgacgttggccgcgccggccaaggtgaaccttagcttgcgcatcatcggc
cggcgcgccgacggctaccacgagctgctgacgttgatgcagccgctgagcctggccgac
gaggtttcggtggaactgagggccggcggcgtggcgctggcttgcgacgacgaacgcctg
atcgagaataatctgatgaccagggcggcggaggcctacttcgccgccctgggcgcgccg
cctggggtcaggctgggcctgaaaaagcgcatccccgtggccgcggggttgggtggcggc
tcctccgacgcggcggcggttcttttggcgctcaacgccctgcacggcggggcgctggat
ccggcccgtttggtcgcgctggccgccggcctgggcgctgacgtggccttttttctggcc
gggcagacggccctttgcagcggcgtgggcgaaatcgtccatcctttgccggtgtttcca
ctgttgcattatgtagtggtcaaccccggcttcgccgtgccaaccgcttgggtttacaag
caattcgatttatcgtggacaagccaaaataactgcaataaaattatttgcctaccgtgc
gctgggcatgcgctgtgtgatattctagtcaacgacctagaaggtgtgacgttgactgct
tatccacagttggtcgacgtcaaacgggcactggcggaagccggggccgtcggggcgctc
atgtccggcagcgggccgtccattttcggcgtattcgccgacgaggggtccgcgacaaaa
gcagcgcacaacctggcggctcgcggtcagtggtgggtggaggcctgccgtggtgttgac
gcctgtgaaggctgctgctgttag

DBGET integrated database retrieval system