KEGG   Desulfarculus baarsii: Deba_0739Help
Entry
Deba_0739         CDS       T01284                                 

Definition
(GenBank) UDP-N-acetylglucosamine1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00520  Amino sugar and nucleotide sugar metabolism
dbr00550  Peptidoglycan biosynthesis
dbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Deba_0739
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Deba_0739
Enzymes [BR:dbr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Deba_0739
Peptidoglycan biosynthesis and degradation proteins [BR:dbr01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Deba_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ADK84111
UniProt: E1QEX5
Position
838270..839544
Genome map
AA seq 424 aa AA seqDB search
MDKLIIEGGRPLVGRVRVSGAKNATLPLMAACLLTGGRNRLRNVPNLRDVGTMAALLREL
GAHVDERPGELTIDTARAEGDECPYELVKTMRASVLALGPMVARSGRGRVSLPGGCAIGE
RPIDQHLKGLEAMGCRIELEGGYVQARAKRLKGAEITFDLITVTGTENIMMAATLAQGRT
VLRNAAREPEVVDLAQALNGAGARIEGAGDSIVTIDGVDGLGSIDHAVMPDRIEAGTFMM
AAGVTRGELTIENAQMEHLTAVVAKLKEAGLRFQQTPKGLVVSARRAPRPVSVITGPYPG
FPTDLQAQFMALMTLCNGSAVIQETIFENRLMHVPELRRLGAEIECGGNTAVVKGVRKLS
GAPVMATDLRASACLVLAGLAAGGQTHISRVYHLDRGYERIDQKLINAGATVRRESEPGP
GKAH
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggataagctgatcatcgagggcggccggccgctggtgggccgggtgcgcgtcagcggg
gccaagaacgccaccttgccgctgatggccgcctgcctgctcaccggcgggcgcaaccgc
ctgcgcaatgtgcccaacctgcgcgacgtgggcaccatggccgcgttgttgcgtgaactg
ggcgcccacgtggatgaaaggcccggcgaactgaccatcgacaccgcccgcgccgagggc
gacgagtgcccctacgagttggtcaagaccatgcgggcctcggtgctggccctggggccg
atggtggcccgctcgggtcggggccgtgtcagcctgcccggcggctgcgccattggcgag
cggcccatcgatcagcacctcaagggcctggaggccatgggctgccgcatcgagttggag
ggcggctatgtccaggccagggccaagcggcttaaaggggccgagatcacctttgatctg
atcaccgtcaccggcaccgaaaacatcatgatggccgccaccctggcccagggccgcacg
gtgctgcgcaacgccgcccgcgagcccgaggtcgtcgatctggcccaggccctcaacggg
gccggggcgcgcatcgagggcgcgggcgactccatcgtgaccatcgacggcgtcgatggc
ttggggtccatcgatcacgccgtgatgcccgaccgcatcgaggccggcactttcatgatg
gccgccggcgtgaccaggggcgagttgaccatcgaaaacgcccagatggagcacctgacc
gccgtggtggccaagctcaaggaggcgggcctgcgctttcagcagacgcccaagggcctg
gtggtcagcgcccgccgcgcgcccaggccggtcagtgtgatcaccgggccgtatccgggc
tttcccaccgatctacaggcccagttcatggccttgatgaccctgtgcaacggcagcgcc
gtgattcaggagacgatctttgaaaaccgcctgatgcacgtgccggagctgcgccgcctg
ggggccgagatcgagtgcggcggcaacaccgccgtggtcaagggcgtgcgcaagctctcg
ggcgcgccggtgatggccaccgacctgcgggcctcggcctgcctggtgctggccggcctg
gccgccggcggccagacgcacatcagccgggtttatcacctggaccggggctacgagcgc
atcgaccagaaactgatcaacgccggggccacggtgcgccgcgagtcggagccggggccg
ggcaaggcgcactga

DBGET integrated database retrieval system