KEGG   Desulfarculus baarsii: Deba_0763Help
Entry
Deba_0763         CDS       T01284                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00790  Folate biosynthesis
dbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Deba_0763
Enzymes [BR:dbr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Deba_0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADK84135
UniProt: E1QEZ9
Position
859039..859908
Genome map
AA seq 289 aa AA seqDB search
MNQMHRVKRRLDLPGGGALELGERTLIMGVVNVTPDSFSDGGRYQDIEAAVAHGLSLVAQ
GADILDVGGESTRPGSDPVSAEEEIARVVPVIAGLARQCEAVISIDTNKAQVAAAAMAAG
ARLINDVTALTGDPAMTAVAVESGAAVVLMHMLGTPKTMQQSPAYDDVVAEVGAYLVQRA
QAVEAAGVARGRIIIDPGIGFGKNLEHNLSLLRNLPRLAELGYPLLLGASRKAFIGQLTG
RPVELRLWGTLGAHVLGAALGADIVRVHDVAPLRDALAVCDAVMAREPR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagatgcatagagtcaaacgtcggctggatctgcccggcggcggcgcgttggag
ctgggcgagcgcacgctgatcatgggcgtggtcaacgtcacgcccgattcgttttccgac
ggcggtcgttatcaagatatagaagcggccgtggcccatggcctgagcctggtggcccag
ggggccgacatcctcgacgtgggcggcgaatcgacccggcccggctccgacccggtttcg
gccgaggaagagatcgccagggtcgtcccggtgatcgccggcctggcccgccagtgcgag
gccgtcatcagcatcgacaccaacaaggcccaggtggccgctgcggccatggcggccggg
gcgcgcctcatcaacgacgtcaccgccctgaccggcgacccggccatgaccgccgtggcc
gtcgaaagcggcgcggcggtggtgttgatgcacatgttgggcacgccaaagaccatgcag
caaagccccgcctacgacgacgtggtggccgaggtcggcgcttatctggtccagcgggcc
caggcggtggaggccgccggcgtggcgcgcgggcgcatcattatcgatccgggcatcggc
tttggcaaaaatctcgaacacaacctgagcctgctgcgcaacctgccgcgcctggccgag
ttgggctatccgctgctgttgggggccagccgcaaggccttcatcggtcagctgaccggc
cggccggtggagctgcgcctgtggggcacgctgggcgcgcacgtgctgggcgcggccctg
ggcgccgatatcgtgcgcgtccacgacgtggcccccctgcgtgacgccctggcggtctgc
gacgccgtcatggcccgggagccccgctga

DBGET integrated database retrieval system