KEGG   Desulfarculus baarsii: Deba_1090Help
Entry
Deba_1090         CDS       T01284                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00020  Citrate cycle (TCA cycle)
dbr00190  Oxidative phosphorylation
dbr00650  Butanoate metabolism
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
dbr01120  Microbial metabolism in diverse environments
dbr01130  Biosynthesis of antibiotics
dbr01200  Carbon metabolism
Module
dbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deba_1090
   00650 Butanoate metabolism
    Deba_1090
  Energy metabolism
   00190 Oxidative phosphorylation
    Deba_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADK84458
UniProt: E1QIN5
Position
complement(1213480..1213848)
Genome map
AA seq 122 aa AA seqDB search
MKFLGSGRTGAFEWFFQRVSGVALVALLGLHFILIHYTGEPGPVTYDKVAPRLASPLYKA
WELLFLVLALYHAMNGVKLVIDDYVHNSTWRSCLLGLSWLVALALLIFGALTIITFSYQP
GA
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcttgggatcggggcgcaccggcgctttcgagtggtttttccagcgcgtttcg
ggcgtggccctggtggcgttgctgggcctgcatttcattttgatccactacaccggcgag
cccgggccggtcacctacgacaaggtggccccgcgcctggcctcgccgctctacaaggcc
tgggagcttttgttcctggttctggccctttatcacgccatgaacggcgtcaagctggtc
atcgacgactacgtccacaacagcacgtggcgctcgtgcctgctgggccttagctggctg
gtcgccttggcccttttgatcttcggggccctgaccatcatcaccttcagctatcagccg
ggagcgtag

DBGET integrated database retrieval system