KEGG   Desulfarculus baarsii: Deba_1114Help
Entry
Deba_1114         CDS       T01284                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dbr  Desulfarculus baarsii
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Deba_1114
  Lipid metabolism
   00071 Fatty acid degradation
    Deba_1114
Enzymes [BR:dbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Deba_1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1234688..1235470
Genome map
AA seq 260 aa AA seqDB search
MAYEFEKIKATQDGAVLVATIDSPPANALGQGVLRDLSALLDQAQADEAVRVIVLCGQGP
KLFSAGADISEFAGLQAGVVPKYNGNEIFSRIETFPKVVIAAMQGAAFGGGLELCLCCHL
RVMSEKAICGLPEVKLGFMPGWGGTQRLPRLIGKTKAMELILTGDFISANQALALGLVCA
LAPAEETVAHAVKLAQKLAAGAPLAQREIIKAIHNGLQTTVADGVKNVEGAGVATLLGSQ
DFKEGAKAFLEKRKAQFVGR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgaatttgaaaaaatcaaagcgacccaggacggcgcggtgctggtggccacc
atcgacagcccgccggccaacgccctgggccagggcgtgctgcgcgacctgagcgccctg
ctggaccaggcccaggccgacgaggccgtgcgggtgatcgtactctgcggccaggggccc
aagctcttttcggccggggccgacatcagcgagttcgccgggctgcaagcgggcgtcgtg
cccaaatacaacggcaatgagatattttcgcgcatcgagacatttcccaaggtggtcatc
gccgccatgcagggcgcggcctttggcggcggcctggagctgtgcctgtgctgccacctg
cgcgtgatgagcgaaaaggccatctgcggcctgcccgaggtcaagctgggcttcatgccc
ggctggggcggcacccagcgcctgccccggctcatcggcaagaccaaggccatggagctg
atcctcaccggcgacttcatcagcgccaaccaggccctggccctgggtctggtgtgcgcc
ctggccccggccgaggagaccgtggcccacgcggtcaagctggcccaaaagctggccgcc
ggcgcgcccctggcccagcgcgagatcatcaaggccatccacaacggcttgcaaaccacc
gtggccgacggcgtgaaaaacgtcgagggcgccggcgtggccactcttttgggcagccag
gacttcaaggaaggggccaaggcgtttttggaaaaacgcaaggcccagttcgtgggccgc
tag

DBGET integrated database retrieval system