KEGG   Desulfarculus baarsii: Deba_1163Help
Entry
Deba_1163         CDS       T01284                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00300  Lysine biosynthesis
dbr01100  Metabolic pathways
dbr01120  Microbial metabolism in diverse environments
dbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Deba_1163
Enzymes [BR:dbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Deba_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 DUF3197
Motif
Other DBs
NCBI-ProteinID: ADK84531
UniProt: E1QIV8
Position
complement(1301707..1302939)
Genome map
AA seq 410 aa AA seqDB search
MDNSQLIIEKVEQYRQEIIEIQRALVATPALGPDNGGQGEAAKAALVQGWLEAMGLAVQR
VDAPDPRAAGGARPNVAATYPGGPGRRVWVLSHLDVVPPGDAALWSSDPWRLRVDGDKLY
GRGVNDNHAGLVSSLIGLKALIDLGIKPAGDVGLILVSDEETSSKHGLAHVLEARPDLFG
PDDLIIVPDSGLEDGSGIEVVEKSMLWLRVEVSGRQVHASMPHKGVNALHAAARMICAVG
EIAERYPQTDPRFDPPGSTMQATRKDAGVQNINTVPGRDVFYLDCRMLPGISLGEVIAEI
RRVFEAIAAEDGATVDVEIVQKLQAPPATPDEAPVVLALRRAVKRVLGLEARPYGIGGGT
VAAFFRQKGLPAAVWQTAVDTAHMPDEWISLDGLIKDAAVFALVYAGFEG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggacaatagtcagctcatcatcgaaaaagtcgaacaatatcgccaggaaatcatcgaa
atccaacgagcgctggtggccaccccggccctggggcccgacaacggcggccagggcgag
gcggccaaggcggccctggtccagggctggctggaagccatggggctggccgtccagcgc
gtggacgcccccgatcccagggcggccggcggcgcgcggcccaacgtggcggcgacctac
cccggtgggccggggcgacgggtctgggtgcttagccacctggacgtggtgccgccgggc
gacgccgcgttgtggagctccgacccctggcgcctgcgcgtcgatggcgacaagctttat
ggccgcggcgtcaacgacaaccacgccgggctggtcagttcgctcatcggcctgaaggcc
ctcatcgacctgggcatcaagccggccggcgacgtggggctgatcctggtctccgacgag
gagaccagctccaaacacggcctggcccacgtgctggaggcgcggcccgatctgtttggc
cccgacgacctgatcatcgtgcccgattcgggcctggaggacggctcgggcatcgaggtg
gtggaaaaatccatgctctggctgcgcgtggaggtgagcggccgccaggtccacgccagt
atgccccacaagggcgtcaacgccctgcacgccgccgcccgcatgatctgcgccgtgggc
gaaatcgccgaacgctatccccagaccgacccgcgcttcgatccgcccggctcgaccatg
caggccacgcgcaaggacgccggcgtgcaaaacatcaacaccgtgcccggccgtgacgtg
ttttacctcgattgccgcatgctgccgggcataagcctgggcgaggtcatcgccgagatc
aggcgcgtcttcgaggccatcgccgccgaggacggggccaccgtcgacgtcgagatcgtg
caaaagttgcaggccccgccggccacgcccgacgaggcgccggtggtgctggccctgcgc
cgggccgtcaagcgcgtgctgggcctggaggccaggccctatggcatcggcggcggcacg
gtggcggcctttttccgccaaaagggcctgcccgcggcggtctggcagacggccgtggac
accgcccacatgccagacgaatggatcagcctcgacggcctgatcaaggacgccgccgtc
ttcgccctggtctacgccggtttcgagggctga

DBGET integrated database retrieval system