KEGG   Desulfarculus baarsii: Deba_1171Help
Entry
Deba_1171         CDS       T01284                                 

Definition
cytochrome bd ubiquinol oxidase subunit I
Orthology
K00425  
cytochrome d ubiquinol oxidase subunit I [EC:1.10.3.-]
Organism
dbr  Desulfarculus baarsii
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome d ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Deba_1171
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Deba_1171
Enzymes [BR:dbr01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.-  
     Deba_1171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1313956..1315290)
Genome map
AA seq 444 aa AA seqDB search
MDVLMLSRLQFAAATFFHFLFVPLTLGLSILVAIMETIYVKTGDEQYKRMAKFWGKLFLI
NFAIGVVTGITLEFQFGTNWSRYSKYVGDIFGSLLAVEATVAFFLESTFIAVWVFGWERL
SPKAHVATIWLVAAASNISAYWIIAANAFMQHPVGYVLRNGRAELDDFIAVATQKFAVLQ
FAHTLSGAYILAGFFVMGICAYHLLRRQNVEFFSRSFRLALNFALIFSVAAAITGDLGGK
EVAQVQPSKLAAMESHWQTQESAPIYLITVPRLGGEGNIVEWLPIPGALSLLAFNDFGAK
VVGLNDIPPEDRPPVLPTFLGFRLMVGLGALFIALTVWGWLKRKQLVDNPTYLKIMLWSL
PLPYLANEAGWMLTEVGRQPWIVWGLMRTSEAFSPIATSQVAISLAAFIVVYGLLGAAAF
YLLAKHAKQGPEMAAATAGARKEG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgttgatgctctcacggctgcagttcgccgcggccacgtttttccattttctc
tttgtcccgctgacgttgggcctatcgatcctggtcgccatcatggagacgatttacgtc
aaaaccggcgacgaacaatacaagcgcatggccaagttctggggcaagctgtttctgatc
aacttcgccatcggcgtggtgacgggcatcacgctggagtttcagttcggcaccaactgg
tcgcgctactccaaatacgtcggcgacatcttcgggtcgctgttggcggtggaggccact
gtggccttctttctggagtcgaccttcatcgcggtgtgggttttcggttgggagcgcctt
tcgcccaaggcccacgtggccaccatctggctggtggccgccgcctccaacatcagcgcc
tactggatcatcgcggccaacgccttcatgcagcatccggtgggctacgtgctgcgcaac
ggccgcgcggagttggacgacttcatcgccgtggccacgcagaaattcgccgtgctgcaa
ttcgcgcacacgctcagcggggcctatatcctggccggatttttcgtgatgggcatctgc
gcctatcacctgctgcgccgacaaaacgtcgaatttttcagccggtcgtttcgcctggcc
ctgaatttcgcgctgatcttcagcgtggccgcggccatcaccggcgacctgggcggcaag
gaagtggcccaggtccagccctccaagctggcggccatggagtcgcactggcagacccag
gagtcggccccgatctatctgatcaccgtgccccggctcggcggcgagggcaacatcgtc
gagtggctgcccatccctggggcgctgtcgcttttggccttcaacgattttggcgccaag
gtcgtgggcctcaatgacatcccgcccgaggatcgaccgccggtgttgcccaccttcctg
ggctttaggctgatggtgggcctgggcgcgctgttcatcgccctgacggtgtggggctgg
ctcaagcgcaagcaactggtcgacaacccgacttatctgaagatcatgctctggtcgttg
cccctgccctatctggccaacgaagccggctggatgctcaccgaggtcggtcgccagcca
tggatcgtctggggcctcatgcgcacttccgaggccttcagtcccatcgccacctcccag
gtggccatcagcctggccgccttcatcgtggtctacgggttgttgggcgcggcggcgttt
tatctgttggccaaacacgccaagcaagggccggagatggccgccgcgaccgccggcgcg
cggaaggagggctag

DBGET integrated database retrieval system