KEGG   Desulfarculus baarsii: Deba_1185Help
Entry
Deba_1185         CDS       T01284                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dbr  Desulfarculus baarsii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deba_1185
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deba_1185
   00640 Propanoate metabolism
    Deba_1185
   00660 C5-Branched dibasic acid metabolism
    Deba_1185
Enzymes [BR:dbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Deba_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1333820..1334989)
Genome map
AA seq 389 aa AA seqDB search
MNVHEYQAKQMLAAFGVPVPKGGLAESAAQAQDVANGLAAEGYVVKAQIHAGGRGKGGGV
KVVKTAAEAAEAAAKMLGMHLVTHQTGPEGKKVRKVWIEQATAIAKELYLAVVLDRASEC
LAVMASPDGGMDIEEVAAKTPERIFATRIDPGQSLWAFQARKLLFGCGLNAAQVRQGETL
LKNLARLAWEKEATLVEINPLVVTAAGDLLAVDAKINFDDSALKRQPDVAALKDPLETDP
LELAATEQGLNYIRLNGNVGTMVNGAGLAMATMDVIKMAGAEPANFLDVGGGASEEMITK
AFEIILEDQNVQAILINIFGGILRCDVLAAGVVAAARKVDLKLPLVVRLEGTNVEEGRRI
LAESDLAFEVAASLSEAAEKIAKVAGGSK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtacacgaatatcaggccaaacagatgctcgcggcctttggcgtgcccgtgccc
aagggcggcttggccgaatcggccgcccaggcccaggacgtggccaatggcttggccgcc
gagggctacgtggtcaaggcccagatccacgccggcggccggggcaagggcggcggtgtc
aaggtggtcaagacggccgccgaggccgccgaggccgcggccaagatgctgggcatgcat
ctggtcacccaccagaccgggcccgagggcaaaaaggtgcgcaaggtgtggatcgaacag
gccacggccatcgccaaggagctttacctggccgtggtgctcgaccgcgcctccgagtgc
ctggccgtgatggcctcgcccgatggcggcatggatatcgaggaagtggccgccaagacc
ccggagcgcatctttgccacgcgcatcgaccccggccagagcctgtgggctttccaggcg
cgcaagctgctgttcggctgcggcctgaacgccgcccaggtgcgccagggcgaaacgcta
ttgaaaaacctggcgcgcctggcctgggaaaaagaagccaccctggtggagatcaacccc
ctggtggtcaccgccgccggcgatctgctggccgtcgacgccaagatcaactttgacgac
agcgccctcaagcgccagcccgacgtggccgccctcaaggatcccctggagaccgacccc
ctggagctggccgccaccgagcagggcctgaactatatccgcctaaacggcaacgtgggc
accatggtcaacggcgcgggcctggccatggccaccatggacgtgatcaagatggccgga
gccgagccggccaacttcctcgacgtgggcggcggcgcctccgaggagatgatcaccaag
gcctttgagatcatcttggaagaccagaatgtccaggcgattttgatcaacattttcggc
ggcattttgcgttgcgacgtgctggccgccggcgtggtggccgccgcgcgcaaggtcgat
ctgaaactgccgctggtggtgcgcctggaaggcaccaacgtcgaggaaggacggcgcatc
ctggccgaaagcgacctggccttcgaagtggccgcgtcactttccgaggcggccgaaaag
atcgccaaggtggcgggagggtccaaatga

DBGET integrated database retrieval system