KEGG   Desulfarculus baarsii: Deba_1224Help
Entry
Deba_1224         CDS       T01284                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dbr  Desulfarculus baarsii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dbr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:dbr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1376798..1378090)
Genome map
AA seq 430 aa AA seqDB search
MQLTPEKLGDLSPQRRERLMARSNEDISSVFDHVRGILADIRARGDQASVDWHKELKADL
TPDDFRVDHAEMTKALGQTPKDLLGCLEKAAVNIRAFHAAQMERPMWQMEVAPGIIAGRK
TTPLDSAGCYVPGGRAAYPSTALMTILPAVVAGVGRVVVCTPPGEGLQVNPLTLAACHIA
GASEIYKLGGPWAIGAMAYGTGVVPKVAKIVGPGNKYVTAAKMQVFGVVDIDSPAGPSEA
LLLADRTANPRHLALDFLSQVEHDPASAAVLVTDDAQLAQAVCQRINDIYPGMPRRQIMD
QGGAYCAVLVADDMDQAIEFTNDYAPEHLQIVTAEPFVTLQRIRHAGSIFMGPWAPVPVG
DYASGTNHTLPTGQGAKMFSGLSVDDFLKKPTFQYLTKDGLASLRQTVTTLAEAEGLPIH
AMTVRERFND
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgacacccgagaaacttggcgacctgagcccccagcgccgggagcgcctcatg
gcgcgctccaacgaggacatctcctcggtcttcgaccacgtccggggcatcctggccgat
atccgcgcccgcggcgatcaggccagcgtcgattggcacaaggaactgaaagccgacctc
acgcccgatgattttcgcgtcgaccacgccgagatgacaaaggccctcggccagacgccc
aaggatctcctgggctgcctggaaaaggccgccgtcaacatccgcgcctttcacgccgcc
cagatggagcggcccatgtggcagatggaagtggccccgggcatcatcgccggccgtaag
accacgcccctggattcggccggctgctacgtgcccggcggccgggcggcctatccgtcc
acggccctgatgaccatcctgccggcggtggtggccggcgtgggccgcgtggtcgtctgc
accccgcccggcgagggcctacaggtcaatcccctgaccctggcggcctgccacatcgcc
ggcgccagcgaaatctacaagttgggcgggccctgggccatcggggccatggcctatggc
acgggcgtcgtgcccaaggtggccaagatcgtcggcccgggcaacaaatacgtcaccgcc
gccaagatgcaggtcttcggcgtggtcgacatcgactcgccggccgggccgtccgaggcc
ctgctcctggccgaccgcacggccaaccccaggcacctggcccttgatttcctctcgcag
gtcgaacacgacccggcctcggccgccgtgctggtcaccgacgacgcccagttggcccag
gccgtctgccagcggatcaacgacatctaccccggcatgccccgccgccagatcatggac
cagggcggggcctactgcgcggtgctggtggccgatgatatggatcaagccatcgaattc
accaacgattacgccccggagcacctgcagatcgtcaccgccgagccattcgtgaccctc
cagcgcatccgccacgccggctccatcttcatgggcccctgggcccccgtgccggttggc
gactacgcctcgggcaccaatcacaccctgcctaccggccagggcgccaagatgttcagc
ggcctcagcgtcgatgacttcctcaagaagccgaccttccaatacctcaccaaggacggc
ctggccagcctgcgccagaccgtgaccaccctggccgaggccgaaggcttgcccatccac
gccatgaccgtgcgcgaacgcttcaacgactga

DBGET integrated database retrieval system