KEGG   Desulfarculus baarsii: Deba_1224Help
Entry
Deba_1224         CDS       T01284                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dbr  Desulfarculus baarsii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Deba_1224
  Amino acid metabolism
   00340 Histidine metabolism
    Deba_1224
Enzymes [BR:dbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Deba_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1376798..1378090)
Genome map
AA seq 430 aa AA seqDB search
MQLTPEKLGDLSPQRRERLMARSNEDISSVFDHVRGILADIRARGDQASVDWHKELKADL
TPDDFRVDHAEMTKALGQTPKDLLGCLEKAAVNIRAFHAAQMERPMWQMEVAPGIIAGRK
TTPLDSAGCYVPGGRAAYPSTALMTILPAVVAGVGRVVVCTPPGEGLQVNPLTLAACHIA
GASEIYKLGGPWAIGAMAYGTGVVPKVAKIVGPGNKYVTAAKMQVFGVVDIDSPAGPSEA
LLLADRTANPRHLALDFLSQVEHDPASAAVLVTDDAQLAQAVCQRINDIYPGMPRRQIMD
QGGAYCAVLVADDMDQAIEFTNDYAPEHLQIVTAEPFVTLQRIRHAGSIFMGPWAPVPVG
DYASGTNHTLPTGQGAKMFSGLSVDDFLKKPTFQYLTKDGLASLRQTVTTLAEAEGLPIH
AMTVRERFND
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgacacccgagaaacttggcgacctgagcccccagcgccgggagcgcctcatg
gcgcgctccaacgaggacatctcctcggtcttcgaccacgtccggggcatcctggccgat
atccgcgcccgcggcgatcaggccagcgtcgattggcacaaggaactgaaagccgacctc
acgcccgatgattttcgcgtcgaccacgccgagatgacaaaggccctcggccagacgccc
aaggatctcctgggctgcctggaaaaggccgccgtcaacatccgcgcctttcacgccgcc
cagatggagcggcccatgtggcagatggaagtggccccgggcatcatcgccggccgtaag
accacgcccctggattcggccggctgctacgtgcccggcggccgggcggcctatccgtcc
acggccctgatgaccatcctgccggcggtggtggccggcgtgggccgcgtggtcgtctgc
accccgcccggcgagggcctacaggtcaatcccctgaccctggcggcctgccacatcgcc
ggcgccagcgaaatctacaagttgggcgggccctgggccatcggggccatggcctatggc
acgggcgtcgtgcccaaggtggccaagatcgtcggcccgggcaacaaatacgtcaccgcc
gccaagatgcaggtcttcggcgtggtcgacatcgactcgccggccgggccgtccgaggcc
ctgctcctggccgaccgcacggccaaccccaggcacctggcccttgatttcctctcgcag
gtcgaacacgacccggcctcggccgccgtgctggtcaccgacgacgcccagttggcccag
gccgtctgccagcggatcaacgacatctaccccggcatgccccgccgccagatcatggac
cagggcggggcctactgcgcggtgctggtggccgatgatatggatcaagccatcgaattc
accaacgattacgccccggagcacctgcagatcgtcaccgccgagccattcgtgaccctc
cagcgcatccgccacgccggctccatcttcatgggcccctgggcccccgtgccggttggc
gactacgcctcgggcaccaatcacaccctgcctaccggccagggcgccaagatgttcagc
ggcctcagcgtcgatgacttcctcaagaagccgaccttccaatacctcaccaaggacggc
ctggccagcctgcgccagaccgtgaccaccctggccgaggccgaaggcttgcccatccac
gccatgaccgtgcgcgaacgcttcaacgactga

DBGET integrated database retrieval system