KEGG   Desulfarculus baarsii: Deba_1227Help
Entry
Deba_1227         CDS       T01284                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dbr  Desulfarculus baarsii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Deba_1227
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Deba_1227
Enzymes [BR:dbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Deba_1227
Two-component system [BR:dbr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Deba_1227
Bacterial motility proteins [BR:dbr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Deba_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1380232..1381329)
Genome map
AA seq 365 aa AA seqDB search
MPDKPIKAMVVDDSAMIREFLRATLDAQPDIEVVATAADPYIARDKFLKLRPTVITLDIE
MPRMDGLTFLEKLMKAHPTPVVMFSSLTQHGAEATIKALALGAVDFVAKPVVNMRENLPD
LAQEIVAKVRSAAGVKAKARRVSPANMQVPRKVEVDEVVSLTKTPPRPGGPMIVLIGAST
GGTVALEDVLCRLPADSPPIAVVQHMPEHFTLAFAQRLNEKAHITIAEAQDGQPITSGVC
LIAPGGKHMLVERNANGYYANVKDGPPVNRHKPSVDVLFRSGVNSAGPNAVAIIMTGMGD
DGAKGLKDLHDCGAFTVAQNEESCVVYGMPKAAVELGAADRIVPLERIAPLVVGLWSQAT
GRTVG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccggacaagcccatcaaggccatggtggtcgacgactcggccatgatccgcgaattt
ttgcgcgcgaccctggacgctcaacccgacatcgaagtggtggccaccgccgccgacccc
tatatcgcccgtgacaagttcctcaagctgcggcccacggtgatcaccctcgacatcgaa
atgccgcgcatggacgggttgaccttcctggaaaagctgatgaaggctcaccccacgccg
gtggtgatgttttccagcctgacccagcacggggccgaggccaccatcaaggccctggcc
ctgggcgcggtggatttcgtggccaagcccgtggtcaacatgcgcgaaaacctgcccgac
ctggcccaggagatcgtggccaaggtgcgctccgccgccggggtcaaggccaaggcccgg
cgggtcagcccggccaatatgcaggtgccgcgcaaggtcgaggtcgacgaggtggtcagc
ctgaccaagacgccgccgcggcccggcggcccgatgatcgtgctcatcggcgcctccacc
ggcggcacagtggccttggaggacgtgctctgtcgcctgccggccgacagcccgcccatc
gccgtggtccagcacatgcccgaacacttcaccctggcctttgcccagcggctcaacgaa
aaagcccacatcaccatcgccgaggcccaggacggccaaccgatcacctccggcgtctgc
ctgatcgcccccggcggcaagcacatgctcgtcgagcgcaacgccaacggttattacgcc
aacgtcaaggacggcccgccggtcaaccgccacaaaccatcggtggacgtgctgtttcgc
tcgggcgtcaacagcgccgggcccaacgccgtggccatcatcatgaccggcatgggcgac
gatggggccaagggcctcaaagatctacacgattgcggcgccttcaccgtggcccaaaac
gaagaatcatgcgtggtctacggcatgcccaaggccgccgtggagcttggcgcggccgac
cgcatcgtgccgttggagcgcatcgcgcccctggtggtggggctgtggagtcaggccacc
ggaaggaccgtgggatga

DBGET integrated database retrieval system