KEGG   Desulfarculus baarsii: Deba_1350Help
Entry
Deba_1350         CDS       T01284                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deba_1350
   01230 Biosynthesis of amino acids
    Deba_1350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deba_1350
  Energy metabolism
   00680 Methane metabolism
    Deba_1350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Deba_1350
Enzymes [BR:dbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Deba_1350
Exosome [BR:dbr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Deba_1350
  Exosomal proteins of melanoma cells
   Deba_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1513322..1514137
Genome map
AA seq 271 aa AA seqDB search
MESRPHIMIRANLILLRHGQSQTNQSQTFTGWLDAPLSDLGRAQAARAGCLLAQAGPPVQ
AAFCSRLSRAAQTLELALAAMGRPDLPRQALWRLNERHVGQLQGVAKDEARARFGPELIH
AWRHGLDLAPPPLSPEDPRHPRHDPLHADVDPALLPASESLGQLVWRVEPVWRGELAPRL
AAGQNLLVAGHGLSLWAVCRLVLADQGLDLPSFSMPNANPLILAFDRRGRLFSMSYLDQA
AAGDLPPLSSLNPLNCRHDGQRAAALVQRRG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggagtcacgcccccacatcatgatccgcgccaacctgattctgctgcgccacggccag
agccaaaccaaccagtcccagaccttcaccggttggctggacgcgccgctttccgacctg
ggccgggcccaggccgcgcgggccggctgtttgctggcccaggccggaccgcccgtgcag
gcggctttttgctcgcgcctgagccgggcggcgcaaacgctggagttggccttggcggcc
atgggccggcccgacctgccgcgccaggccctctggcggctcaacgagcgccacgtgggc
cagttgcagggcgtggccaaggacgaggcgcgggcccggtttggcccggagctgatccac
gcctggcgtcacggcctggatctggccccgccgcccctgagccccgaagacccccgtcac
ccccgccacgacccgctccacgccgacgtggacccggcccttttgccggccagcgaatcg
ttggggcagttggtttggcgggtggagccggtctggcgaggcgagttggccccacgcctg
gccgccggacagaacctgctggtggccggccacggcctttcgctgtgggcggtctgccgc
ctggttttggccgaccagggcctggatttgcccagtttttccatgcccaacgccaacccc
ctgatcttggcctttgaccgtcgcggccggttgttctccatgagctatctggaccaggcc
gccgccggcgatctaccgccgctttcgtcattgaatccgctgaattgccgccacgatggc
cagcgggccgccgccctggtccagcgccgggggtga

DBGET integrated database retrieval system