KEGG   Desulfarculus baarsii: Deba_1598Help
Entry
Deba_1598         CDS       T01284                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
dbr  Desulfarculus baarsii
Brite
Enzymes [BR:dbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Deba_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1770602..1773631
Genome map
AA seq 1009 aa AA seqDB search
MANEFFVRPILNSPYEYPLKHWELDEGQPTGHVIESRRRAEYITPIPKPKKVRGLATQKM
LPLDEGKGLSDQQQQYDPTPIINELRRQVDQWREMPNPNDWLVTPETARLLSYWRHHHFS
DIRPFFCQVEAVETAIWLTEVAPKMGKAGKRFLDYLANANNDANPGLMRLALKLATGAGK
TTVMAMIIAWQTVNAVRTPGSKKFTRGFLVVTPGITIKDRLRVLQPNDPDNYYRNRELIP
GDMLVDLERAKIVITNYHALMLRERMDISKGGRSLLQGRGPAISTLETEGQMIQRVMPDL
MGMKNIMVINDEAHHCYRERPGSAEIEDLKGEDKDEAKSNNEAARVWISGLEMVGRKLGL
NRVFDLSATPFFLRGSGYAEGTLFPWTMNDFSLMDAIECGIVKLPRVPVADDVPGEDMPR
LRNLWAHIGKDMPKKNRSKSKSLDPLKIPPMLQNALQALYGHYERTFNLWQEAGIASPPC
FIVVCSNTASSKLVYDFISGFQRQNKDGSFTIQNGQLKLFRNFDESGNPLPKPRTLLIDS
EQLESGEALKDDFRETFKDEIERFRREIIERTGNRNGADNLSDQELLREVMNTVGKEGTL
GASIRCVVSVSMLTEGWDASNVTHVLGVRAFGTQLLCEQVIGRALRRQSYDVNEDGRFNV
EYADVLGVPFDFTAKPVVAPPQKPRETVQVKAVRPDRDHLEITFPRVMGYRTELPEERLT
AKFNKDSILELNQDLVGPSITENSGIIGESVNLTLEDLEKVRPSTIAYELASHLVLNKWR
DSDEEPKLYLFGQLKRIAKQWMDECLVCADGTYPGMLRYHDLKDTACERITKGIMDPLLV
GDRPVKAILDPYNPTGSTRHVNFRTSKTERWQTSPNHCHINWVVLDSSWEGQFCRVVEGH
PQVKAYVKNHNLGFDVPYRFGAENRIYRPDFIVIIDDGRPDPLNLVVEIKGYRGEDTKEK
KSTMETYWVPGVNNLGSYGRWAFAEFTEIFKLESDFRKLIDSFTAQQAA
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgagttttttgtacggcctatcttaaactctccttatgaatatcccctgaaa
cattgggagcttgacgaaggtcaacccaccgggcatgtgatcgagtcacgtcgaagagca
gaatacatcacaccgattcccaaacccaaaaaagtcaggggtctggcaacgcaaaagatg
ttgccgttggacgagggcaagggtctctcggaccaacagcaacaatatgacccgaccccg
ataatcaatgagcttcgtaggcaagttgaccagtggcgggaaatgcctaatcccaacgat
tggctggtaactccagagactgctcgcctgctcagttattggcggcaccaccatttcagc
gacatccgcccgtttttttgccaggtcgaagcggtcgaaacggctatctggctgacggag
gtcgcccccaagatgggcaaagcgggtaagaggttccttgattacctggccaacgccaat
aatgacgccaaccctggtttgatgcgcttggccctgaagctggccacgggcgctggcaaa
accacggtcatggccatgattatcgcctggcaaactgttaatgcggtgcgcacccctggc
agcaaaaagttcacacgcggttttttggtggtcacgcccggtataaccatcaaggaccgc
ctgcgcgtgctgcagcccaacgacccagacaactattaccgcaaccgtgagttgatcccc
ggcgacatgctcgtcgaccttgagcgggccaaaatcgtcatcaccaactaccacgctctt
atgctgcgggagcggatggatatttccaagggcggccgctcacttctccaagggcgtgga
ccagcaatcagcacgcttgaaaccgaaggtcagatgatccagcgggtcatgcccgacctg
atgggcatgaaaaatatcatggtcatcaacgacgaagctcatcactgctatcgcgaaagg
ccaggttcagccgaaatcgaagaccttaaaggcgaagacaaagatgaggccaagagcaac
aatgaggccgcgcgggtctggatttcggggctggaaatggttggccgtaagctgggcctg
aacagagtcttcgacctttcggccacgccatttttcctgcggggctccggctatgccgaa
ggcacgctgttcccctggaccatgaacgatttttcgctgatggatgctatcgagtgcggc
atcgtcaaattgccgcgcgtgcccgtggccgacgacgtccccggcgaagacatgcccagg
ctgcgcaacctatgggcccacatcggcaaggacatgcccaagaaaaaccgcagcaaatcc
aagagcctcgaccctttaaagatcccgccgatgctgcaaaacgccctccaggccctttac
ggccattacgaaaggacattcaatctctggcaagaagccggcatcgcttcgccgccgtgc
ttcattgtcgtttgcagcaatacggcttcatccaagttggtctatgacttcatctccgga
ttccagcgtcaaaacaaagatggctcgtttactattcaaaacggccagttgaaattgttc
cgcaactttgacgaaagcggtaacccgctgccaaaaccgcgcactttgcttatagacagt
gagcaactggaatcgggcgaggccctgaaggatgattttcgtgagacgttcaaagacgaa
atagaacgctttcgccgcgagatcattgaacgaaccggcaaccgtaacggggccgacaat
ctgagcgaccaggaactgctgcgggaagtaatgaataccgtgggcaaggagggcaccctc
ggcgcatcgatacgttgcgtggtttcggtttcgatgctcaccgaaggatgggatgccagc
aacgtgacccacgtcctcggcgtgcgcgccttcggcacccagcttttgtgcgagcaggtc
atcggccgggccctgcgccgccagtcctacgacgtaaacgaagatggccggttcaacgtg
gaatacgccgacgtattgggggtgccgttcgatttcacggccaagcccgtggtggccccg
ccgcagaaaccacgcgagaccgtgcaggtgaaggccgtgcggcccgaccgcgatcatttg
gagataaccttccctcgcgtgatgggttatcgaactgagttgcccgaagagcggctgacg
gcgaaattcaacaaagactccattcttgagctgaaccaggacctggttggcccatccatc
accgaaaactcgggcattatcggcgaaagcgtgaacctgaccctggaagaccttgaaaag
gtccgcccgtcgaccatcgcctatgagctggcctcgcacctggtgctcaacaagtggcgc
gattcggacgaggagcccaagctctaccttttcggccagctcaagcgcatcgccaaacag
tggatggacgagtgcctggtatgcgcagacggcacctatccgggcatgcttcgctatcac
gacttgaaggacacggcctgtgagcgtatcaccaagggcatcatggacccgctcttggtg
ggagaccggcccgtaaaggccattctggacccgtacaaccccacaggctccacccgacat
gtcaatttccgaacgtccaagacagagcgctggcaaacatctccgaaccattgccatatc
aactgggtcgtcctcgatagctcctgggaaggccagttttgccgcgtggtcgaggggcac
ccacaagtgaaagcttacgtaaagaaccacaacctgggctttgacgtgccatatcgcttt
ggcgctgaaaaccgcatctaccggccggacttcatcgtcatcatcgatgacggcaggccc
gacccgctgaatctggtggtggagatcaaaggctatcgcggcgaagacaccaaagaaaag
aaatccaccatggagacatattgggtgccgggcgtgaacaacctgggatcatacggccgc
tgggcctttgcggaattcaccgaaattttcaagctggagtccgatttccggaaactgatc
gattccttcaccgcccagcaagcggcctga

DBGET integrated database retrieval system