KEGG   Desulfarculus baarsii: Deba_1853Help
Entry
Deba_1853         CDS       T01284                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dbr  Desulfarculus baarsii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Deba_1853
Enzymes [BR:dbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Deba_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2059009..2061171)
Genome map
AA seq 720 aa AA seqDB search
MSEQTNTTMRGRVERITFHNPENAYTVAKVAVAGQPGLMTLVGKMPGVAEGQEVEASGRL
VLHAKFGQQLEVESCHLAQPGDAEGVRRYLASGLVKGVGPVMAGRIVDVLGEGAIEKIVN
DPRSLTAVPGVGAKRAASIAQAVISQGMLREAMILLQGHGVGPGTVMRIHRRFGDQTLAV
AQNEPHRLAAEVRGIGFATADQIARRLGMAADHPSRVAAGLLYSLRQAGDEGHVFLPYDE
LMPQAAGLLGLPQAALGPAFARLHQERRIVVEEAFGPRAVYLAGMLALEQSAAQSVARLS
RGRGLLAPERVAKAVEWAGRSLHFEPSTGQAEALRALLAAPLAVLTGGPGTGKTTLVRAL
INIAQRMGQNVALAAPTGRAARRLAEASGRPAQTLHRLLEFSPKENSFLRGADRPLEGQL
IIVDEASMIDIWLGAHLLAATADGACLVLVGDADQLPPVGPGLFFRQIIDSGAARVGRLT
EIFRQGRASLIVENAHRILGGRMPTLPAPGQEADFYFLEEPDPERAAELVRDLVAKRLPN
KYGFDPIDDIQTLAPMHKGAMGCHNLNRLLRQALNPAGQGPGPGVGDKVMQSRNNYELEV
FNGDMGQVLRADDEGLAVSIDGRVVTYSLAEAAELNLAYAVTVHKSQGSEYPAVVLALGN
EHFVLLNRPLLYTAVTRGKKLVVVVGSATALRRAVEHAQPIMRHSLLGRRIKALLGTDND
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcaaacaaacacgaccatgcgcggccgggtggagcgcatcaccttccacaac
ccggaaaacgcctacaccgtggccaaggtggccgtggccggccagccggggctgatgacg
ctggtgggcaagatgcccggcgtggccgagggccaggaagtggaggccagcggacggctg
gtgctgcacgccaagttcggccagcaattggaggtggagtcgtgtcacttggcccagccc
ggcgacgccgagggcgtgcggcgctatctggcctcgggcctggtcaagggcgtggggccg
gtgatggccgggcgcatcgtcgatgtgctgggcgagggcgccatcgaaaagatcgtcaac
gacccgcgcagcctgaccgccgtgccgggcgtcggggccaagcgcgccgccagcatcgcc
caggccgtgatcagccaaggcatgctgcgcgaggccatgatcctcttgcagggccacggc
gtggggccgggcacggtgatgcgcatccatcgtcgctttggcgaccagaccctggccgtg
gcgcaaaacgaaccccatcgcctggccgccgaggtgcggggcattggtttcgccaccgcc
gaccagatcgcccgccgcctgggcatggccgccgaccacccctcgcgggtggccgccggg
ctgctctacagcctgcgccaggccggggacgaaggccacgtttttttgccatacgacgaa
ctcatgccccaggccgccggcctgttgggcctgccccaggccgccctgggcccggccttc
gcccgactgcatcaagagcgccgcatcgtcgtcgaggaagcctttggcccacgggcggtc
tatctggccggcatgttggccttggagcaaagcgcggcccaaagcgtggcccggctgagc
cgggggcgggggctgcttgcgcccgagcgggtggccaaggccgtggagtgggccgggcgt
agcctgcatttcgagccgtcgacgggccaggccgaggccctgcgggcgctgttggccgcg
cctctggccgtgctgaccggcgggccgggcacgggcaagaccaccctggtgcgggcgctg
atcaacatcgcccagcgcatgggccaaaacgtggccctggccgcgcccaccgggcgagcg
gcccgacgcctggccgaggccagcggtcgcccggcccagaccctgcaccggctcttggag
ttcagccccaaggaaaacagctttttgcgcggggccgatcggccattggaaggccagttg
atcatcgtcgacgaggccagcatgatcgacatctggctgggagcccatctgctggcggcc
acggccgacggggcctgtttggtcctggtgggcgacgccgaccaactgccgccggtgggg
ccggggctgttttttcggcagatcatcgacagcggcgcggccagggtagggcggctgacg
gaaatattccgccagggccgggccagcctgatcgtcgaaaacgcccaccgcatcctgggc
ggtcggatgcccactttgcccgcgccaggccaggaggctgatttctatttcttggaagag
cccgaccccgaacgggcggccgaactcgtccgcgacctggtggccaagcgcctgcccaac
aagtatggtttcgaccccattgacgacatccagaccttggcccccatgcacaagggggcc
atgggctgccacaacctcaaccgcctgctgcgtcaggccctcaaccctgccggccagggg
ccggggccgggcgtgggcgacaaggtgatgcagtcgcgcaacaactacgagttggaggtt
ttcaacggcgacatgggtcaggtgctgcgagccgacgacgaaggactggcggtgtccatc
gacggacgggttgtgacttacagcctggccgaagcggccgagttgaacctggcctacgcg
gtgacggtgcataaatcccagggcagcgaatatccggcggtggtgttggccctgggcaac
gagcatttcgtgctgctgaacaggccgctgctgtacacggcggtgaccaggggcaaaaaa
ctggtggtggtggttggttcggccacggcgctgcgtcgggcggtggagcacgcccagccg
atcatgcgtcacagcctgctggggcggcggatcaaggcgctgttgggaacggacaatgac
tga

DBGET integrated database retrieval system