KEGG   Desulfarculus baarsii: Deba_1968Help
Entry
Deba_1968         CDS       T01284                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00010  Glycolysis / Gluconeogenesis
dbr00051  Fructose and mannose metabolism
dbr00562  Inositol phosphate metabolism
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
dbr01120  Microbial metabolism in diverse environments
dbr01130  Biosynthesis of antibiotics
dbr01200  Carbon metabolism
dbr01230  Biosynthesis of amino acids
Module
dbr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deba_1968
   00051 Fructose and mannose metabolism
    Deba_1968
   00562 Inositol phosphate metabolism
    Deba_1968
Enzymes [BR:dbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Deba_1968
Exosome [BR:dbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Deba_1968
  Exosomal proteins of bladder cancer cells
   Deba_1968
  Exosomal proteins of melanoma cells
   Deba_1968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADK85333
UniProt: E1QL68
Position
2181753..2182505
Genome map
AA seq 250 aa AA seqDB search
MNRRIMVAGNWKMYKTIDQAVALAKAVAAGPARQGLDVLLCPNFVCLEAVVRAVAGSHVQ
VGGQNLHWQDEGAFTAEISGPMLRSVGASHVIIGHSERRQFFGETEKTVRMRLAAALRHG
LKPIVCVGETQAERESGQTDDVLASQLAGGLAGLSAAEMVKVTLAYEPVWAIGTGLTASD
EQAQQVHAFIRAWLAARFDNQVANSCGILYGGSVKPANAAGLLRQKDIDGALVGGASLDA
DSFLGIIAAV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcgaatcatggtggccggcaactggaagatgtacaagaccatcgaccaggcc
gtggccttggccaaggccgtggccgccggaccggcccgtcagggcctggatgtgctcttg
tgcccgaacttcgtctgcctggaggccgtggttcgggccgtggccggcagccacgtgcag
gtgggcgggcaaaacctgcactggcaagacgaaggggccttcacggccgaaatcagcggc
cccatgttgcgttctgtcggggccagccacgtaatcatcggccactccgagcgccggcag
tttttcggcgagacggaaaagaccgtgcgcatgcgcctggcggccgccttgcgccacggg
ctcaagcccatcgtctgcgtgggcgagacccaggccgagcgcgagtccggccagaccgat
gacgtcctggccagccaactggccggcggcttggccggcctgagcgccgccgagatggtc
aaagtgaccttggcctacgagccggtctgggccatcggcacgggcctgaccgccagtgac
gagcaggcccagcaggttcacgcctttatccgcgcctggctggccgcccgttttgacaat
caggttgcaaactcgtgcggaatcctgtatggaggtagtgtcaagccggccaacgcggcc
ggccttttgcgtcaaaaagatatcgacggcgctcttgttggcggcgcatcactggacgcg
gacagtttccttggtataattgcggccgtctga

DBGET integrated database retrieval system