KEGG   Desulfarculus baarsii: Deba_1968Help
Entry
Deba_1968         CDS       T01284                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deba_1968
   01230 Biosynthesis of amino acids
    Deba_1968
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deba_1968
   00051 Fructose and mannose metabolism
    Deba_1968
   00562 Inositol phosphate metabolism
    Deba_1968
Enzymes [BR:dbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Deba_1968
Exosome [BR:dbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Deba_1968
  Exosomal proteins of bladder cancer cells
   Deba_1968
  Exosomal proteins of melanoma cells
   Deba_1968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2181753..2182505
Genome map
AA seq 250 aa AA seqDB search
MNRRIMVAGNWKMYKTIDQAVALAKAVAAGPARQGLDVLLCPNFVCLEAVVRAVAGSHVQ
VGGQNLHWQDEGAFTAEISGPMLRSVGASHVIIGHSERRQFFGETEKTVRMRLAAALRHG
LKPIVCVGETQAERESGQTDDVLASQLAGGLAGLSAAEMVKVTLAYEPVWAIGTGLTASD
EQAQQVHAFIRAWLAARFDNQVANSCGILYGGSVKPANAAGLLRQKDIDGALVGGASLDA
DSFLGIIAAV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcgaatcatggtggccggcaactggaagatgtacaagaccatcgaccaggcc
gtggccttggccaaggccgtggccgccggaccggcccgtcagggcctggatgtgctcttg
tgcccgaacttcgtctgcctggaggccgtggttcgggccgtggccggcagccacgtgcag
gtgggcgggcaaaacctgcactggcaagacgaaggggccttcacggccgaaatcagcggc
cccatgttgcgttctgtcggggccagccacgtaatcatcggccactccgagcgccggcag
tttttcggcgagacggaaaagaccgtgcgcatgcgcctggcggccgccttgcgccacggg
ctcaagcccatcgtctgcgtgggcgagacccaggccgagcgcgagtccggccagaccgat
gacgtcctggccagccaactggccggcggcttggccggcctgagcgccgccgagatggtc
aaagtgaccttggcctacgagccggtctgggccatcggcacgggcctgaccgccagtgac
gagcaggcccagcaggttcacgcctttatccgcgcctggctggccgcccgttttgacaat
caggttgcaaactcgtgcggaatcctgtatggaggtagtgtcaagccggccaacgcggcc
ggccttttgcgtcaaaaagatatcgacggcgctcttgttggcggcgcatcactggacgcg
gacagtttccttggtataattgcggccgtctga

DBGET integrated database retrieval system