KEGG   Desulfarculus baarsii: Deba_2076Help
Entry
Deba_2076         CDS       T01284                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00230  Purine metabolism
dbr01100  Metabolic pathways
Module
dbr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Deba_2076
Enzymes [BR:dbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Deba_2076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 AAA_30 Thymidylate_kin Zeta_toxin NTPase_1 ABC_tran AAA_29 Mg_chelatase AAA_17 MMR_HSR1 APS_kinase AAA
Motif
Other DBs
NCBI-ProteinID: ADK85441
UniProt: E1QIC4
Position
complement(2299609..2300217)
Genome map
AA seq 202 aa AA seqDB search
MSATGQIFVLSGPPGAGKSTVGAMVRQNLPDLAYSVSFTTRAPRPGERDGVDYHFVDRQA
FIQRLERGDILEHVEIFGNMYGTSAQVIDQTIGQGVDLFLDTDVNGGKALRGHYPQGVFI
FIVPPSRAELERRLRQRGTETEDNIRLRLARVGYELAAAQDYTHLVINDDLNKAAAQVEA
IITTDRLRTERQLTRIKREWGL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaccggccagatcttcgtgctttcgggcccgcccggcgcgggcaagtccacc
gtcggggccatggtgcggcaaaacctgcccgatctggcctattcggtcagcttcaccacc
cgcgccccccggcctggcgagcgcgacggcgtggattatcactttgtcgaccgccaggcg
ttcatccagcgcctggagcgcggcgacattttggagcacgtggagatcttcggcaacatg
tatggcacctcggcccaggtcatcgatcagaccatcggccaaggcgtcgacctgtttttg
gacaccgacgtcaacggcggcaaggccctgcgcggccattatccccaaggcgtgttcatc
ttcatcgtgcctccttcacgggccgaactggagcgccgtctgcgccagcggggcaccgaa
accgaggacaacatccgcctgcgcctggccagggtcggctatgaattggccgcggcccag
gactacacccacctggtgataaatgacgacctgaacaaggccgcggcccaggtcgaggcc
atcatcaccaccgaccgcctgcgcacggagcgccaattgacgcgcatcaagcgggaatgg
ggcctctaa

DBGET integrated database retrieval system