KEGG   Desulfarculus baarsii: Deba_2259Help
Entry
Deba_2259         CDS       T01284                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Deba_2259
Enzymes [BR:dbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Deba_2259
Exosome [BR:dbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deba_2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2513647..2515164)
Genome map
AA seq 505 aa AA seqDB search
MKRRYVGAIDQGTTSTRFFIYDHDCNVVAQAQREHKQYFPQPGWVEHDAAEILHNAYEVT
QRALTKAGLTSGDLAAIGVTNQRETIVAWDGQTAAPLGRAIVWQDARTAEICRALEKKHG
PELFWRVCGLPVSTYFSAAKIKWLLENSPAVARTARDGRLMLGTMDAWLIWRLTGGRHGG
VHATDATNASRTLLMDIQNVAWDEEMLGVFGVERQWLPEIRPSCGVYGHTDPNGPLEAAV
PIAGNLGDQQAALFGQCCFDAGQAKNTYGTGCFLLLNTGSRLARSQGGLLSTVAFQEADG
AVSYALEGSVAVAGSLVQWLRDNLGLIRSAHEIEPLARTVADNGGLYLVPAFSGLFAPHW
DAKARGLMIGLTHYINKGHIARAALEAVAMQTWEVVRAMTDDAGAALSQMRVDGGMVENE
LLMQFQSDILDLPVIKPQNTETTVLGAAFAAGLAVGYWSDKQSLRAKAAVEKTWRPTMGQ
AQRQRRVAAWLRAVERAKGWLVEED
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagatacgtcggcgccatcgatcaaggcaccaccagcaccaggtttttcatc
tacgatcacgattgcaacgtcgtcgcccaggcccagcgcgaacacaagcaatactttccc
cagccggggtgggtcgagcacgacgccgccgagatcctgcacaacgcctacgaagtgacc
cagcgggccctgaccaaggccggcctgaccagcggcgacctggcggccatcggcgtgacc
aaccaacgcgagaccatcgtcgcctgggatgggcaaaccgccgcgcctctgggccgggcc
atcgtctggcaagacgcccgcacggccgaaatctgccgggcgttggaaaaaaaacacggc
cccgagcttttctggcgtgtctgcggcctgcccgtctccacctatttttcggcggctaaa
atcaaatggttgctggaaaattcgccggccgtggcccggaccgcccgtgacggccgcctg
atgctgggcaccatggacgcctggctgatctggcggctgaccggcggccgccacggcggc
gttcacgccaccgacgccaccaacgccagccgcacactgctgatggacatccagaacgtg
gcctgggacgaagagatgctgggcgtctttggcgtggagcgccagtggctaccggaaatt
cgcccatcctgcggcgtctacggccacaccgaccccaacggcccgctggaggcggccgtg
cccatcgccggcaacctgggcgatcagcaggcggccctgttcggccaatgctgcttcgac
gccggccaggccaagaacacctacggcacgggctgctttttgctgttgaacaccggcagc
cgcctggcgcgctcccaaggcgggctgctgagcaccgtggcctttcaggaggccgacggc
gcggtcagttacgccctggaaggctcggtggcggtggccggttccttggtgcagtggctg
cgcgacaatctggggctgatcaggtcggcccacgagatcgagcccctggcccgcacggtg
gccgacaacggcgggctttatctggtgccggccttttccggtcttttcgccccccactgg
gacgccaaggcccgtggcctgatgatcggcctgacccactatatcaacaagggccacatc
gccagggccgccctggaggcggtggccatgcagacctgggaggtggtgcgggccatgacc
gacgacgccggggcggccctttcgcagatgcgcgtcgatggcggcatggtcgaaaacgag
ctgttgatgcagttccagagcgatatcctggatctgccggtgatcaagccgcaaaacacc
gaaaccaccgtgctgggcgcggcctttgccgccggcttggccgtgggctattggagcgac
aagcagagcctgcgcgccaaggcggccgtggaaaaaacctggcggccgaccatgggccaa
gcccagcgtcagcgccgcgtggcggcctggctgcgcgccgtggagcgggccaagggttgg
ctggtcgaggaggattga

DBGET integrated database retrieval system