KEGG   Desulfarculus baarsii: Deba_2259Help
Entry
Deba_2259         CDS       T01284                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dbr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2513647..2515164)
Genome map
AA seq 505 aa AA seqDB search
MKRRYVGAIDQGTTSTRFFIYDHDCNVVAQAQREHKQYFPQPGWVEHDAAEILHNAYEVT
QRALTKAGLTSGDLAAIGVTNQRETIVAWDGQTAAPLGRAIVWQDARTAEICRALEKKHG
PELFWRVCGLPVSTYFSAAKIKWLLENSPAVARTARDGRLMLGTMDAWLIWRLTGGRHGG
VHATDATNASRTLLMDIQNVAWDEEMLGVFGVERQWLPEIRPSCGVYGHTDPNGPLEAAV
PIAGNLGDQQAALFGQCCFDAGQAKNTYGTGCFLLLNTGSRLARSQGGLLSTVAFQEADG
AVSYALEGSVAVAGSLVQWLRDNLGLIRSAHEIEPLARTVADNGGLYLVPAFSGLFAPHW
DAKARGLMIGLTHYINKGHIARAALEAVAMQTWEVVRAMTDDAGAALSQMRVDGGMVENE
LLMQFQSDILDLPVIKPQNTETTVLGAAFAAGLAVGYWSDKQSLRAKAAVEKTWRPTMGQ
AQRQRRVAAWLRAVERAKGWLVEED
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagatacgtcggcgccatcgatcaaggcaccaccagcaccaggtttttcatc
tacgatcacgattgcaacgtcgtcgcccaggcccagcgcgaacacaagcaatactttccc
cagccggggtgggtcgagcacgacgccgccgagatcctgcacaacgcctacgaagtgacc
cagcgggccctgaccaaggccggcctgaccagcggcgacctggcggccatcggcgtgacc
aaccaacgcgagaccatcgtcgcctgggatgggcaaaccgccgcgcctctgggccgggcc
atcgtctggcaagacgcccgcacggccgaaatctgccgggcgttggaaaaaaaacacggc
cccgagcttttctggcgtgtctgcggcctgcccgtctccacctatttttcggcggctaaa
atcaaatggttgctggaaaattcgccggccgtggcccggaccgcccgtgacggccgcctg
atgctgggcaccatggacgcctggctgatctggcggctgaccggcggccgccacggcggc
gttcacgccaccgacgccaccaacgccagccgcacactgctgatggacatccagaacgtg
gcctgggacgaagagatgctgggcgtctttggcgtggagcgccagtggctaccggaaatt
cgcccatcctgcggcgtctacggccacaccgaccccaacggcccgctggaggcggccgtg
cccatcgccggcaacctgggcgatcagcaggcggccctgttcggccaatgctgcttcgac
gccggccaggccaagaacacctacggcacgggctgctttttgctgttgaacaccggcagc
cgcctggcgcgctcccaaggcgggctgctgagcaccgtggcctttcaggaggccgacggc
gcggtcagttacgccctggaaggctcggtggcggtggccggttccttggtgcagtggctg
cgcgacaatctggggctgatcaggtcggcccacgagatcgagcccctggcccgcacggtg
gccgacaacggcgggctttatctggtgccggccttttccggtcttttcgccccccactgg
gacgccaaggcccgtggcctgatgatcggcctgacccactatatcaacaagggccacatc
gccagggccgccctggaggcggtggccatgcagacctgggaggtggtgcgggccatgacc
gacgacgccggggcggccctttcgcagatgcgcgtcgatggcggcatggtcgaaaacgag
ctgttgatgcagttccagagcgatatcctggatctgccggtgatcaagccgcaaaacacc
gaaaccaccgtgctgggcgcggcctttgccgccggcttggccgtgggctattggagcgac
aagcagagcctgcgcgccaaggcggccgtggaaaaaacctggcggccgaccatgggccaa
gcccagcgtcagcgccgcgtggcggcctggctgcgcgccgtggagcgggccaagggttgg
ctggtcgaggaggattga

DBGET integrated database retrieval system