KEGG   Desulfarculus baarsii: Deba_2477Help
Entry
Deba_2477         CDS       T01284                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dbr  Desulfarculus baarsii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dbr00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dbr00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dbr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2734927..2736591
Genome map
AA seq 554 aa AA seqDB search
MLVAIMRRRWAGPLAAALLILALAATAAVAAPAAKNVIMLIPDGCGAEQYALARWVKGAP
LAFDHILTGAIRTHIADSVIADSAPAGTALATGTRTGNKIVGLSPKAKGLLPGQPDPGPE
ALRPRASVLEAARLMGKSTGLVATATITDATPADFIAHVPRRKLEPEIAKQMVHAAPEVI
MGGGRHFFLPKNAGGKRTDGLDLLALLAQKGYQLPRDRDELARVKKGPVAGLFADDFMAP
ERDRPHLAPAQPSLAQMTAKAIEILSQNERGFFLMVEASLVDWACHNNDPGHLVGDLLAY
DQAVQIALDFAKKDGQTLVVAVSDHNTGGMSIGNRSTDNTYTSTKLEALLAPIAQMRLST
MAIWNAMGDRPNKQALRALIKKWWGMDLSDDEARQIMAIAAAYPKLPQYGVGRVLSATRT
VIGWSTHGHTGGDVPLFAFGPGRPTGLLDEPEVAHAVARAMGADLRQLDQRLFAEAATAL
TWATLAERLTPRGWLLEARINGRLAQLEAGGNILRLDGEELILEGVVVRVEDTGKWYLPQ
KAATLIMAPPARQD
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgttgcaatcatgcgtcggcgctgggcgggcccgctggccgccgcgctgctgatc
ctggccctggcggccacggcggccgtcgccgcgccggcggccaagaacgtgatcatgctc
atccccgacggctgcggggccgagcaatacgccctggcccgttgggtcaagggcgcgccg
ctggccttcgaccacatcctcaccggggccatccgcacccacatcgccgattcggtcatc
gccgattcggccccggccggcacggccctggccaccggcacgcgcaccggcaacaagatc
gtgggcctttcgcccaaggccaagggcctgctgcccggtcagcccgaccccggccccgag
gcgctgcggcctcgggccagcgtgctggaggcggcccggctcatgggcaagtccaccggc
ctggtggccaccgccaccatcaccgacgcaaccccggccgacttcatcgctcacgtgccc
aggcgcaagctggagcccgaaatcgccaagcaaatggtccacgccgccccggaggtgatc
atgggcggcggccggcatttctttttgcccaaaaacgccggcggcaaacggaccgacggc
ctggatctactggccctgctggcccaaaagggctatcaactgccccgcgaccgcgacgaa
ctggcgcgcgtcaaaaaaggccccgtggccggcctgttcgccgacgacttcatggccccc
gagcgcgaccggccccacctggcccccgcacaaccatcgctggcccaaatgaccgccaag
gccatcgagattctgtctcaaaacgaacgcggcttctttttgatggtcgaggccagcctg
gtcgactgggcctgccacaacaacgaccccggccacctggtcggcgacctgctggcctat
gaccaggccgtgcaaatcgccttggatttcgccaaaaaggacggccaaaccctggttgtc
gccgtcagcgaccacaacaccggcggcatgagcatcggcaaccgctccaccgacaacacc
tacacatccaccaagctggaggccctgctagcgcccatcgcccagatgcgcctgtcgacc
atggccatctggaacgccatgggcgatcgccccaacaagcaagccttgcgcgcgttgatc
aagaagtggtggggcatggacctgagcgacgacgaggcccggcaaatcatggccatcgcc
gccgcctatcccaagctgccacaatacggcgtgggccgcgtgctcagcgccacgcgcacg
gtcatcggttggagcacccacggccacaccggcggagacgtgcctttgttcgcctttggg
ccgggccggcccacgggcctgctcgacgagcccgaagtggcccacgccgtggccagggcc
atgggcgccgacctgcgtcagctcgaccagcgcctgttcgccgaggcggccacggccctg
acctgggccacgcttgccgagcgtctcacgccgcgcggctggctgctggaggcgcgtatc
aatggccggctggcccagttggaggccggcggcaacatcctgcgcctagacggcgaggag
ctgattttggagggcgtggtcgtgcgcgtcgaggatacgggcaagtggtatctgccccaa
aaagccgccacgttgatcatggcccctccggcgcggcaagactga

DBGET integrated database retrieval system