KEGG   Desulfarculus baarsii: Deba_2503Help
Entry
Deba_2503         CDS       T01284                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deba_2503
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deba_2503
   00620 Pyruvate metabolism
    Deba_2503
   00640 Propanoate metabolism
    Deba_2503
  Energy metabolism
   00680 Methane metabolism
    Deba_2503
Enzymes [BR:dbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Deba_2503
Lipid biosynthesis proteins [BR:dbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Deba_2503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2778193..2779827)
Genome map
AA seq 544 aa AA seqDB search
MQFDTSKTAAYEQLYNGFHWNVPEKYNFGFDVVDKWAADRTKLALLSLSEDGEQAEYMSF
FELSRLSDRFANVLVDLGLKKGDRVLIILHSIPQWYVAMIAMFKLGVVPMPGTVLLTAKD
ISYRVNRAEAVMVITDLDHVARVDEVARECPTLKHKMVVDGKTPGWYAYDAQMAAAKAKL
ERGVLGEVVTADPLMLYFTSGTTGQPKMVRHSHAYPMGHEVTARYAQSLQPTDLHWTVSE
TGWAKAAWGKLFGQMIVGAAIVQRKSLGRFNPENTLRALERYGVTTFCAPPTVYRMLIQQ
DLKAYDFTLRHCMSAGEPMNPEVIKAWREGTGLDIYDFYGQTETVCILSNYPFMPLKYGS
VGKPTPGHDVRVVDENGVELAPGDEGHIAMYLGDQRPPGLMMEYWLDDDAMAGSFKGDYY
YTGDRAYRDEEGYFWFVGRGDDIIKSSGYRVGPFEVESALQEHPAVAECAVVGAPDPEGV
RGMVIKAFVVLVKGYEASEALTKEIQDYVKNTTAPYKYPRLIEYREELPKTISGKILRRE
LRKQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgcaattcgacaccagcaaaacggcagcatatgaacagctctacaacggattccactgg
aacgttcccgaaaaatacaatttcggcttcgacgtggtggacaaatgggccgccgaccgc
accaaactggcccttctatccctcagcgaggatggcgaacaagccgaatacatgagcttt
ttcgagctgagccgcctgtccgaccgcttcgccaacgtgcttgtcgacctgggcctgaaa
aagggcgaccgggtcttgatcatcctgcacagcattccccagtggtacgtggccatgatc
gccatgttcaagctgggcgtggtgcccatgccgggcacggtgctgctgacggccaaggac
atcagctaccgcgtcaaccgggccgaggcggtgatggtcatcaccgacctggaccacgtg
gcccgcgtcgacgaggtggcccgcgagtgccccacgctcaagcacaagatggtcgtcgac
ggcaagacccccggttggtacgcctacgacgcccagatggccgcggccaaggccaagctg
gagcgcggcgtcctgggcgaggtggtcaccgccgacccgttgatgctttacttcaccagc
ggcaccaccggccagcccaagatggtccgccacagccacgcctaccccatgggccacgag
gtcaccgcccgttacgcccaatccctgcaacccaccgacctgcactggaccgtctcggag
acgggctgggccaaggccgcctggggcaagctcttcggccagatgatcgtgggcgcggcc
attgtccagcgcaagagcctgggccgcttcaaccccgagaacacgctcagggccctggag
cgctacggcgtgacgaccttctgcgccccgcccacggtctatcgcatgctcatccagcag
gatttgaaggcctacgacttcaccctgcgccactgcatgagcgccggcgaacccatgaac
cccgaggtgatcaaggcctggcgcgagggcacgggcctggacatctacgacttctacggc
cagaccgaaacggtgtgcatcctctccaactaccccttcatgccgttgaagtatggcagc
gtcggcaagcccaccccggggcacgacgtgcgcgtggtcgatgaaaacggcgtggagctg
gccccgggcgacgagggtcacatcgccatgtacctgggcgaccagcgcccgccgggcctg
atgatggaatattggctcgacgacgacgccatggccggctctttcaagggcgattactat
tacaccggcgaccgcgcctaccgcgacgaggagggctacttctggttcgttggtcgcggc
gacgacatcatcaagagctcgggctaccgcgtggggcccttcgaggtggagtcggccctg
caggaacacccggccgtggccgagtgcgccgtggtcggcgcgcccgatcccgagggcgtg
cgcggcatggtcatcaaggcctttgtcgtgctggtcaagggctatgaagcctccgaggcg
ctgaccaaggagattcaggactacgtgaagaacaccaccgcgccctacaagtatccgcgc
ctgatcgaataccgcgaggagctgcccaagaccatcagcggcaagatcctgcggcgggag
ctgcgcaagcaatag

DBGET integrated database retrieval system