KEGG   Desulfarculus baarsii: Deba_2654Help
Entry
Deba_2654         CDS       T01284                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dbr  Desulfarculus baarsii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Deba_2654
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Deba_2654
Enzymes [BR:dbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Deba_2654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2945974..2946900
Genome map
AA seq 308 aa AA seqDB search
MSWKRKHLLGLEGLSAEEIGVVLDTAESLKEINARPIKKVPTLRGRTVVLFFYEPSTRTK
TSFDLACKRLSADAVALAPKTSSLTKGETLIDTAQTLQAMSPDLIVMRHSSSGAPHLLAR
HVNVSIINAGDGAHEHPTQALLDMLTIREKKGRVQGLEVAIIGDITHSRVARSNIIGLRT
MGARVRVYGPPTLLPPHAATLGARVARSMDEAVEGADVVMMLRVQQERLHDVLFPSLREY
SRLYGLGESHLRRAAEGVIVMHPGPINRGVEIAPQVADGPYSVILDQVANGVAVRMALLY
LMIGAEGL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgagctggaagcgcaaacatcttttgggcctggaggggctgagcgccgaggagatcggc
gtggtgctcgacaccgccgaatcgctcaaggaaatcaacgcccggcccatcaaaaaagtg
cccaccctgcgcggccggacagtggtgctttttttctacgagccgtccacgcgcaccaaa
acgtcttttgacctggcctgcaagcgcctctcggccgacgccgtggccctggcccccaag
accagctcgctgaccaagggcgagacgctcatcgacaccgcccagaccttgcaggccatg
tcgcccgacctcatcgtcatgcgccattcgtcctcgggcgcgccccatctgctggcccgc
cacgtcaacgtctccatcatcaacgccggcgacggggcccacgaacaccccacccaggcc
ctgctggacatgctgaccatccgcgagaaaaaaggccgcgtccagggcctggaggtggcc
atcatcggcgacataacccattcgcgggtggcccgctccaacatcatcggcctgcggacg
atgggcgcgcgggtgcgcgtctacggcccgccgaccctgctgccgccccacgcggccacg
ctgggcgcgcgcgtggcccgctcgatggacgaggccgtggagggagccgacgtggtgatg
atgctgcgcgtgcagcaagagcgcctgcacgacgtgctgtttccgtcgttgcgcgaatat
tcgcggctctacggcctgggcgaaagccacctgcgccgcgccgccgagggcgtcatcgtc
atgcatcccgggccgatcaaccgcggcgtggagatcgcgccccaggtggccgacgggccc
tattcggtgatcctcgaccaggtggccaacggcgtggccgtgcgcatggccttgttgtat
ctgatgatcggcgcggaggggctgtga

DBGET integrated database retrieval system