KEGG   Desulfarculus baarsii: Deba_2695Help
Entry
Deba_2695         CDS       T01284                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deba_2695
   00030 Pentose phosphate pathway
    Deba_2695
   00051 Fructose and mannose metabolism
    Deba_2695
   00052 Galactose metabolism
    Deba_2695
   00500 Starch and sucrose metabolism
    Deba_2695
   00520 Amino sugar and nucleotide sugar metabolism
    Deba_2695
  Nucleotide metabolism
   00230 Purine metabolism
    Deba_2695
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Deba_2695
Enzymes [BR:dbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Deba_2695
    5.4.2.8  phosphomannomutase
     Deba_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2992799..2994154)
Genome map
AA seq 451 aa AA seqDB search
MQRNIFREYDIRAVVDKEITDGDVSLLGRAMGAHFLANGVERLTLGRDVRLSSDRYRDLL
LEGLLSTGLTVIDCGVCTTPILYFSVFHLNAGGGVMITASHNPPEYNGFKVVLGKSTIHG
AQIQRIHDLAQAGQFPSGRGKVSQHDIITDYMDHVANNIRLARRLRIGLDCGNATGGLVA
PQLLARMGVEVAPLYCQVDGAFPNHEPDPTVMKNLVDLQKLVVAQGLEAGVAFDGDCDRV
GVVDEKGRPIFGDMLLAILARDVLRQQPGATIIGEVKCSKNLYDDIAAHGGRPIMWKAGH
SLIKQKMAETGAALAGEMSGHIFFKHRWFGFDDGLYAALRLLELMSRTDKPLSTWLDGLP
PVVNTPEIRVDCPDEHKFAVVAAVARRMAGHDVVDVDGVRVNFADGWGLARASNTQPALV
LRFEATSQEGLERIRELIEGAVERAKKEVGA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcaacatcttccgcgagtatgacatccgcgccgtggtcgataaagagatcacc
gacggcgacgtatcgttgctgggccgggccatgggcgcgcactttctggccaacggcgtg
gagcgtctcaccctgggccgcgacgtgcgcctcagctccgaccgctaccgcgacctgctg
ctggagggcctgctgtccaccggcctgacggtgatcgactgcggcgtctgcaccacgccg
atcttgtatttttcggtgtttcacctgaacgccggcggcggcgtgatgatcaccgccagc
cataatccgccggaatataacggcttcaaggtggtgctgggcaaatcgaccatccacggc
gcgcagatccagcgcatccacgacctggcccaggccggccaattcccctcgggccgaggc
aaggtcagccagcacgacatcatcaccgactacatggaccacgtcgccaacaatatccgc
ctcgcaagacgcctgcgcatcgggctcgactgcggcaacgccaccggcggcctggtggcc
ccccaactgttggcgcgcatgggcgtggaagtcgcgccgctctattgccaggtggacggc
gcctttcccaaccacgagcccgaccccacggtgatgaaaaatctggtcgacctgcaaaag
ctggtggtcgcgcaaggcctggaggccggcgtcgcctttgacggcgactgcgaccgggtg
ggcgtggtcgatgaaaagggccggcccatttttggcgacatgctgctggccatcctggcc
cgcgacgtgctgcgccaacaaccgggggccacgatcatcggcgaggtcaagtgcagcaaa
aacctctacgacgacatcgccgcccacggcggccggcccatcatgtggaaggccggccac
agcctgatcaagcagaaaatggccgagaccggcgcggccctggccggcgagatgagcggg
catatctttttcaaacaccgctggttcggctttgacgacgggctctacgcggcgctacgc
ctgctggagctgatgtcccggaccgacaagccgctttcgacctggctcgacggcctgccg
ccggtggtcaacacgcccgagatccgcgtcgactgccccgacgaacacaagttcgccgtg
gtggcggccgtggcccggcgcatggccggccacgacgtggtcgatgtcgacggcgtgcgg
gtcaacttcgccgacggctggggcctggcgcgggccagcaacacccagccggcgctggtg
ctgcgcttcgaggccaccagccaggagggcctggagcgcatccgcgagctcatcgagggg
gcggtggagcgggccaagaaagaagtcggggcctag

DBGET integrated database retrieval system