KEGG   Desulfarculus baarsii: Deba_2710Help
Entry
Deba_2710         CDS       T01284                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dbr  Desulfarculus baarsii
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dbr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3003604..3004671
Genome map
AA seq 355 aa AA seqDB search
MNPREQLVQVCRLAYQRGYMAASDGNVSLRLDDGNVLITPSGRSKAFIQPEDILCVDLEG
GVISGQGKPSSEGQLHYLVYKERPDVAAVVHAHPPTATAFSLAGRHLDCRALPELMIHLG
AAPTAPYATPTTADLPAAVKPYVAGCNAMLLAHHGSLTMAANLERAWALTEKLEHAAITL
LAAEQLGGARPLAQHDLDRLTELGRSYGLRRDAAVQAPPPPLAQRLKVEHLPETTEFATA
KRHPDARGMAHLIVDDRPLRRVCLLTLEPGKGFRGGHVHNRKTEGFYVAQGAAVLEAVCA
LSGEKTRLELGVGDLVWLPPGVAHRIWASQPLVFVELTDRPYDKNDDAPFNFEEA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttgaacccgcgtgagcaactggtgcaggtctgccgcctggcctatcagcgaggctacatg
gccgccagcgacggcaacgtctcgctgcgcctggacgacggcaacgtcttgatcaccccc
agcggccgcagcaaggccttcatccagcccgaggacatcctctgcgtcgacctggagggc
ggggtgatcagcggccaaggcaaacccagcagcgagggccaactgcactatctagtatat
aaagagcgccccgacgtggccgccgtggtccacgcccatccgcccacggccaccgccttc
agcctggccggccgccatttggactgccgcgcgctgcccgagttgatgatccacctgggg
gcggcgcccaccgcgccctacgccacgcccaccaccgccgacctgccggcggcggtcaaa
ccctacgtggccggctgcaacgccatgcttctggcccaccacggctcgctgaccatggcc
gccaacctggagcgggcctgggccctgaccgaaaagctcgaacacgccgccatcaccctt
ttggccgccgaacaactgggtggggcccggcccctggcccagcatgatctggaccggctg
accgagttgggccgaagctacggcctgcgccgcgacgccgccgttcaagcgccgccgccg
cccctggcccagcgcctgaaggtggagcatctgcccgagaccacggagttcgccaccgcc
aagcgtcaccccgacgcccggggcatggcccacctcatcgtcgacgacaggcccctgcgc
cgggtctgcctgttgacgctggagccgggcaagggctttcgcggggggcatgtgcataac
cgcaagaccgagggcttttacgtggcccagggcgcggccgtgctggaggccgtctgcgcg
ctcagcggcgagaaaacgcgcctggagttgggcgtgggcgacctggtctggctgccgccg
ggcgtggcccaccgcatttgggccagccagccgcttgtgtttgtggaattgaccgacagg
ccctatgataaaaacgacgacgcgccctttaacttcgaggaggcttga

DBGET integrated database retrieval system