KEGG   Desulfarculus baarsii: Deba_2788Help
Entry
Deba_2788         CDS       T01284                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dbr  Desulfarculus baarsii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dbr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dbr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3085712..3087247
Genome map
AA seq 511 aa AA seqDB search
MHFDQLTRLIGPESLLGHAPTAELTGVCCDSRQAGPGMVFVAVVGHSADGHAYVAAAAAA
GATAAVVQRPVEADIAQIVVPDSRLALSALADEFAGRPSQRLKLVGVTGTNGKTTICHLA
RAIMAQRWPTGMIGTVETCFAQVRRPAAMTTPDAVTLQKTLAEMLANGVEAAAMEVSSHA
LDQHRADHCRFDVGLFTNLSRDHLDYHPDMADYFRAKRLLFTELLPWSARQGKRPVSVIC
LDDDHGRVLADQARGTGLALLTYGLAPGADVGGRVLAGGVDGMTVRIDHPGGSLEFHSRL
VGRYNLQNIVGAAAVGLALGLSPEEIKAGLEGVAGVPGRLQRVPGPDRSPAVFVDYAHSP
EAIAAALAVLRPLCAGRLICVFGAGGDRDKGKRPLMGRAAGQAADFCVLTSDNPRTEDPM
AIIDMVEAGLVESEARRCDNPAAGQRAYAVEADRAAAIAMAIQAAGPADVVLIAGKGHED
YQIIGRVKRHFDDREQALTAMTAKAARLGEQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgaccaactgacgcgcctgatcgggcccgaatcgctcctgggccatgcgccg
acggccgaactgaccggcgtctgctgcgattcgcgccaggccgggccgggcatggtcttc
gtggccgtcgtcggccacagcgccgatggccacgcctatgtggcggcggcggcggcggcc
ggggcgacggcggccgtggtccagcggccagtggaggccgacatcgcccaaatcgtcgtc
cccgacagccggctggccctctcggccctggccgacgagttcgccggccggcccagccaa
cgcctcaagctggtgggcgtcaccggcaccaacggcaagacgaccatctgccacctggcc
agggcgatcatggcccagcgttggcccacgggcatgatcggcaccgtcgagacctgcttc
gcccaggtgcgccggcccgcggccatgaccacccccgacgccgtgaccctgcaaaagacc
ctggccgagatgctggccaacggcgtggaggcggcggccatggaggtcagcagccacgcc
ctggatcaacaccgggccgatcactgccgcttcgacgtggggctgttcaccaacctcagc
cgcgaccacctggactatcaccccgacatggccgactatttccgggccaagcgcctgttg
ttcaccgagcttctgccctggtcggcccgccagggcaagcggccggtctcggtgatctgc
ctcgacgatgatcacggccgcgtgctggccgatcaggccaggggcacggggctggccctg
ctgacctacggcctggcccccggcgcggacgtgggcggccgcgtgctggccggcggggtc
gacggcatgacggtgcgcatcgatcaccccggcgggtcgctggagtttcactcgcgcctg
gtgggccgctacaatctgcaaaacatcgtcggcgcggcggcggtgggcctggctctgggg
ctttcgcccgaggaaatcaaggccggcctggagggcgtggccggcgtgcctggccggctg
caacgcgtccctgggcctgaccgttcgccggcggtttttgtcgactacgcccactcgccc
gaggccatcgccgcggccctggccgtgttgcggccgctctgcgccggccgcttgatctgc
gtcttcggggccggtggcgaccgcgacaagggcaagcggcccctgatgggccgcgccgcc
gggcaggccgccgacttctgcgtgttgaccagcgacaacccgcgcaccgaagaccccatg
gccataatcgacatggtcgaggccgggctagttgaaagcgaggcccggcggtgcgacaat
cccgccgccggccagagggcctacgccgtcgaagccgaccgcgccgcggccatcgccatg
gccatccaggcggccgggccagcggacgtggtgctcatcgccggcaagggacacgaggat
taccagattatcggccgcgtcaagcggcatttcgacgaccgcgaacaagccttgacggcc
atgaccgccaaggccgcgcgcctgggagaacaatag

DBGET integrated database retrieval system