KEGG   Desulfarculus baarsii: Deba_2958Help
Entry
Deba_2958         CDS       T01284                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dbr  Desulfarculus baarsii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Deba_2958
Enzymes [BR:dbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Deba_2958
Exosome [BR:dbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Deba_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3260661..3261644
Genome map
AA seq 327 aa AA seqDB search
MSFPLVRMRRLRRNETIRRMVAETTLGVSDLIYPMFVCPGKGVRQPVGSMPGVDRFSVDT
LVEECKQVADLGVPAVILFGIPEKKDALGRGAYDKNGPVPLALRALRRAVPGLALAADVC
MCEYTDHGHCGILDKDTVHNDATLELLAKAAVVYAQAGAHIVAPSDMMDGRVGEIREALD
EAELPDTLIMSYAAKYCSAFYGPFREAADSAPQFGDRKTYQMDPANVRQALREVALDVEE
GADIVMVKPALPYLDVLAHMRDEFDLPLAAYHVSGEYSMIKAAAQLGWIDHDRVMMESLL
SIKRAGADMILTYFAKEAAKLLAGGGK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttcccctggtgcgcatgcgccgcctgcggcgcaacgagaccatcaggcgcatg
gtcgccgagaccaccctcggcgtcagcgacctgatctaccccatgttcgtctgccccggc
aagggcgtgcgccaaccggtgggctccatgcccggcgtcgatcgcttcagcgtcgacacg
ctggtcgaggaatgcaagcaggtggccgatctgggcgtgccggcggtgatcctctttggc
atacccgagaaaaaagacgccctgggccgcggggcctacgacaaaaacggccccgtgccc
ctggccctgcgcgccctgcgccgcgccgtgcccggtctggcgctggcagccgacgtgtgc
atgtgcgaatacaccgaccacggccactgcggcattttggacaaagacaccgtgcacaac
gacgccaccttggagcttttggccaaggcggcggtggtctacgcccaggccggggcccac
atcgtggccccctctgacatgatggacggccgcgtgggcgagatccgcgaggccctcgac
gaggccgagctgccagacaccctgatcatgagctacgccgccaaatactgcagcgccttc
tatggccccttccgcgaggccgccgacagcgcgccccagttcggcgaccgcaagacctat
cagatggacccggccaacgtgcgccaggccctgcgcgaggtggccctggacgtcgaggag
ggggccgacatcgtcatggtcaagccggccctgccctatctggacgtgctggcccacatg
cgcgacgagttcgacctgccgctggccgcctatcacgtctcgggcgaatactcgatgatc
aaggccgcggcccaactgggctggatcgaccacgaccgggtgatgatggagtcgttgctt
tcgatcaagcgggccggcgccgacatgatcctgacctatttcgccaaggaggcggccaag
ctgctggccgggggcggcaaatga

DBGET integrated database retrieval system