KEGG   Desulfarculus baarsii: Deba_2980Help
Entry
Deba_2980         CDS       T01284                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dbr  Desulfarculus baarsii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Deba_2980
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deba_2980
  Amino acid metabolism
   00310 Lysine degradation
    Deba_2980
Enzymes [BR:dbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Deba_2980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3285803..3287065
Genome map
AA seq 420 aa AA seqDB search
MASDIVIPKLGMTMASAKLAAWKAAEGEWITEGQPVMVIETEKVTQDVEALADGFLHILA
APGAVAQVGEAVGQLAADEAELKALQAAAPAPEGLAAAPAAAPSAGEPAAPAAPGGRVKI
TPLAKKIARENGLDYRRLTGSGPGGRIKRADVERALKEGPPPAAEAPAAQSAAAWPGEVI
EGKRVKDSLPLSGIRAVIAEHMHKSLQNSAQLSAMGEFDVAELVRLRQSLIAHQEMIGAR
ISYTDLLVYIVARALKKNPLINSSVVGDQIKLWEDINIGVAVSLPMQKYDAGLIVPVIHD
ADKLSLTEISLRLKDLRRRCQEGTIGLEDLGGGTFTISNVGGFGQGYVFTTPIINQPQAA
ILGVGAILDRPVVQPDGQIGVGKLMNFSLTFDHRAINGAPIGLFLGTIQEMIKTPGLLLA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgatatcgtcatccccaagcttggcatgaccatggccagcgccaagctggcc
gcctggaaggccgccgaaggtgagtggatcaccgagggccagccggtgatggtcatcgaa
accgaaaaagtgacccaggacgtcgaggccctggccgacggatttttgcacatcctggcc
gcgccgggcgcggtggcccaggtcggcgaggccgtgggccaactggccgccgacgaggcc
gaactcaaggccctgcaagcggcggcccccgcccccgagggcctggccgccgcgccagcc
gccgcgccaagcgccggcgagccggccgccccggccgcgcccggcggtcgggtcaagatc
acgcccctggccaagaagatcgcccgcgaaaacggcctggactacaggcgcctcacgggc
agcggcccaggcgggcgcatcaaaagggccgacgtggagcgggccctgaaggaaggcccg
ccgcccgcggccgaggccccggccgcccagtcggccgccgcctggcccggcgaggtcatc
gagggcaagcgggtcaaggactcgctgccgctcagcggcatccgcgcggtcatcgccgag
cacatgcacaaaagcctgcaaaattcggcccagctttcggccatgggcgagtttgacgtg
gccgaactggttcgcctgcgccaatcgttgatcgcccaccaggagatgatcggcgcgcgg
atttcctacaccgatctgctggtctacatcgtggccagggcgctgaaaaaaaacccgctg
atcaactccagcgtggtcggcgatcagatcaagctgtgggaggacatcaacatcggcgtg
gccgtgagcctgcccatgcaaaaatacgacgccggcctgatcgtgccggtgatccacgac
gccgacaagctcagcctcaccgagatcagcctgcgcctgaaggacctgcgccggcgctgc
caggaggggaccatcggcctggaagacctcggcggcggcaccttcaccatctccaacgtc
ggcggctttggccagggctacgtcttcaccacgcccatcatcaaccagccccaggcggcg
atcttgggcgtgggggccatcctcgaccggccggtggtccagcccgacggccaaattggc
gtgggcaagctgatgaacttcagcctgaccttcgaccaccgggccatcaacggcgcgccc
atcggcttgttcctgggcacgatccaagagatgatcaagacgccgggcctgctgctggcc
tga

DBGET integrated database retrieval system