KEGG   Desulfarculus baarsii: Deba_3115Help
Entry
Deba_3115         CDS       T01284                                 

Definition
(GenBank) Cellulase
Organism
dbr  Desulfarculus baarsii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3449707..3450774
Genome map
AA seq 355 aa AA seqDB search
MDLFETLRALCAPLGPSGREDQVRALIGQLAGPHAHRLETDRMGNLRAWINPERRPLLML
DAHMDEVCFVVQRIEQGGWLRIAATAGFEPRVLPGARVIIQPRPGREVVGVVGLLPPHLE
TPADREKALPIERLFVDIGAASEQEAREAGVEVGSPAVADAGGGRLGAKGFYQRNLDDRA
GCAALLELLRRLAIDPPDLGVVCNFAVAEEVGLRGATTAAFDLDPDLALAVDVTMADTPG
ADPAKQVSTLGGGPVVTVLDGRIVVPWAMVDSLEEAAKAIGAPIQRKTPPYGGTDAGAIH
LARGGVPCGVLSIPGRYIHSPVSLINLDDLAATVDVLERWARSAGQLAELLAGRR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttcgagactctccgcgccctctgcgcgcccctgggcccctcgggccgcgag
gaccaggtgcgcgccctcatcggccagttggccgggccccacgcccatcgtctggaaacc
gaccgcatgggcaacctgcgcgcctggatcaaccccgagcgccggccccttctgatgctc
gacgcccacatggacgaggtctgtttcgtcgtccagcgcatcgagcagggcggctggctg
cgcatcgccgccaccgccggcttcgagccccgcgtgctgccaggcgcgcgggtaatcatc
cagccccggccgggccgcgaggtcgtcggcgtggtcggcctcctgccgccccacctggaa
accccggccgaccgcgaaaaggccctgcccatcgagcgattgttcgtcgacatcggcgcg
gccagcgaacaggaggcccgcgaggccggcgtggaggtcggctcgccggcggtggccgac
gccggcggcggccgcctgggcgcaaaaggcttttatcagcgcaacctggacgaccgggcc
ggttgcgcggcgctgctggagctgctgcgccgcctggccatcgatccacccgacctgggc
gtggtctgcaacttcgccgtggccgaggaagtcggcctgcgcggggccaccaccgccgcc
ttcgacctggatccggacctggccctggccgtggacgtgaccatggccgacacgcccggg
gccgatccggccaagcaggtcagcacgctgggcggggggccggtggtcacggtgctcgac
gggcggatcgtcgtgccctgggcgatggtcgattcgctggaagaggcggccaaggccatc
ggcgcgcccatccagcgcaagacgccaccctacggcggcaccgacgccggggccatccat
ttggcccggggcggcgtgccctgcggggtgctctccatccccggccgctacatccactcg
cctgtttcgctgatcaacctggatgacctggccgccaccgtcgatgtgctggagcgctgg
gcgcgttcggcgggccagttggccgagcttttggctggccggcgctga

DBGET integrated database retrieval system