KEGG   Desulfarculus baarsii: Deba_3201Help
Entry
Deba_3201         CDS       T01284                                 

Definition
thiamine pyrophosphate domain-containing TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
dbr  Desulfarculus baarsii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:dbr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dbr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dbr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dbr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dbr00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dbr00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:dbr00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:dbr00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3543394..3544356)
Genome map
AA seq 320 aa AA seqDB search
MSKAAEAIKNVEKISPKNMPLVEPLSRGHRACQGCGEVLALRQVLKAVGKQVIACSATGC
MEIISSPYPQTAWEVPWIHVAFENVAAVASGVEAGRKALIRKGRIQDDNTKVMAFAGDGA
TADIGLQALSGAMERGHDFVYVCLDNEAYMNTGIQRSSSTPYGAMTTTSPPGAKSKGQST
WKKNMPLIAAAHGIPYVATASPAFHLDLMNKARKAAAVPGPAYLHIYSPCPTGWRCGPDT
AIEASRLVVQTRVFPLFEVIDGRYVLTRDITKPKPVADYLKSQRRFAHLKDEDIEFIQKR
VDEEWERLLNLVKATNPEAK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcagccgaggcaatcaagaacgtcgagaagatctcgcccaagaacatgccc
ctggtcgagccgctctcccgcgggcatcgcgcctgccagggctgcggcgaggtgttggcc
ctgcgccaggtgctcaaggccgtgggcaagcaggtcatcgcgtgcagcgccaccggctgc
atggagatcatcagctcgccctatccgcagacggcttgggaagtgccctggatccacgtg
gccttcgaaaacgtcgcggccgtggccagcggcgtggaggccggccgcaaggccctgatc
cgcaagggccgcatccaggacgacaacaccaaggtcatggccttcgccggcgacggcgcc
accgccgacatcggcctccaggccctctccggggccatggagcgcggccacgacttcgtc
tatgtctgcctggacaacgaagcctacatgaacaccggcattcagcgctccagctccacg
ccctacggcgccatgaccaccaccagcccgccgggggccaagagcaagggccagtccacc
tggaagaaaaacatgcccctgatcgccgcggcccacggcattccctacgtggccacggcc
agcccggccttccacctggacctgatgaacaaggcccgcaaggccgccgccgtgcccggc
ccggcctacctgcacatctattcgccgtgccccaccggctggcgttgcgggcccgacacg
gccatcgaggcctcgcgcctggtggtccagacccgcgtcttcccgctgttcgaggtcatc
gacgggcgctacgtgctcacccgcgacatcaccaagcccaagccggtggccgactatctc
aagagccagcgccgcttcgcccacttgaaagatgaagatatagaatttattcaaaaaaga
gtggacgaagagtgggagcgcctgctaaatttagtaaaggctacgaacccggaggccaag
tga

DBGET integrated database retrieval system