KEGG   Desulfotomaculum carboxydivorans: Desca_0030Help
Entry
Desca_0030        CDS       T01498                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dca03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
37924..38526
Genome map
AA seq 200 aa AA seqDB search
MLYYSGPVARLVDEFAKLPGIGPKTAQRLAFHILNAPPEAAQNLARALIEVRQSIKRCSI
CCNLTDEDPCHICRDTTRNPKILCVVEEPRDVVAMEKARGYRGLYHVLHGAISPIEGVGP
DNLTIKELLNRLQTGEVEEVILAANSDVEGETTALYLARLLKPLGVKVTRIAHGIPVGSD
LEYADAMTLNKALEGRGEFG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctttactattccggcccggtggcccggttggtggatgagtttgccaagctgcccggt
attgggcctaaaactgcccagcggttggcctttcatattttgaacgccccgccggaagca
gcccaaaatttagcccgggcattaatcgaggttcggcaatccattaagcgatgttctatc
tgttgtaacctgacagatgaagatccctgccatatttgccgtgacactacccgtaacccc
aaaattttatgtgtggtggaagaaccccgggatgtggtggccatggaaaaggctcggggt
taccgggggttgtaccatgtactgcatggggctatttcacccatagaaggtgtggggcct
gataatcttaccatcaaagaattgttaaatcgcctgcaaaccggtgaggtggaagaggtg
atactggcggctaattccgatgtggaaggggaaaccaccgccctctacctggcccgcctg
ctaaaaccattgggtgtgaaggtaacccgcattgcccacggtattccggtgggctcggat
ttggaatatgccgatgccatgaccttaaacaaggccctggaaggccgcggggagtttggt
taa

DBGET integrated database retrieval system