KEGG   Desulfotomaculum carboxydivorans: Desca_0119Help
Entry
Desca_0119        CDS       T01498                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dca  Desulfotomaculum carboxydivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dca00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Desca_0119
Enzymes [BR:dca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Desca_0119
Exosome [BR:dca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desca_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
120691..122193
Genome map
AA seq 500 aa AA seqDB search
MVKKYVLALDQGTTSCRAILFDRDSNIKGVAQKEFTQIYPKAGWVEHDAEEIWSTQYGVI
AEVIAKTGINPEEIASIGITNQRETTVVWDKTTGKPVYNAIVWQCRRTAGICDQLKAKGL
EQVFRTKTGLVLDAYFSGTKVKWILDNVEGAREKAEKGQLLFGTMDTWLIWNLTGGKVHV
TDYSNASRTLMYNIRELRWDEELLKELDVPASMLPEVRPSSEVYGETDPKNFLGHAVPIA
GVAGDQQAALFGQACYQPGMAKNTYGTGCFMLMNTGDKLYDSKNGLLTTIAWGIDGKVEY
ALEGSIFIAGAAIQWLRDGLKVLEEAPDSEYFASKVADTDGVYLVPAFAGLGAPYWDMRA
RGAIVGLTRGTTKEHIIRAALDSLAYQTKDVLGAMEADSNIKLQALKVDGGAVANNLLMQ
FQADILGVPVERPKVIETTALGAAYLAGLAVGFWQSKEELASRWQLDRRFESQMDDTKRN
KLYDGWKRAVTRSMDWAIED
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaagtatgtgctggccttagaccagggtacaaccagttgccgagcaatcttg
ttcgaccgcgacagcaacattaaaggcgtggcccagaaggaatttactcaaatttatccc
aaggccggttgggtagaacatgatgcggaggaaatctggagcacccagtacggcgtgatc
gccgaagtcattgccaaaaccggcattaaccccgaagaaatcgcttccattggtattaca
aatcagcgggaaaccacggtagtatgggataagacaaccggcaaaccggtctataatgcc
atcgtctggcagtgccgccgtactgccggcatttgcgatcaactgaaggccaagggctta
gagcaagtattcagaaccaaaacaggcctggtgctagatgcttatttctccggcaccaag
gtcaagtggattttagacaatgtggagggcgctcgggaaaaggcagaaaagggccagttg
ctctttggaactatggatacctggttaatttggaatctgaccgggggtaaagtccatgtt
accgattattccaacgcttcccgtaccctgatgtataacattcgggaacttcgctgggac
gaagaactcctaaaggaactggatgtaccggccagcatgttaccggaagttcgtccttcc
agtgaggtttatggcgaaaccgatcctaaaaacttcctcggccatgccgtccccattgcc
ggagttgccggtgatcagcaggcggctttgtttggccaggcatgctaccaacccggcatg
gctaagaatacctacggcaccggctgctttatgctgatgaacaccggtgacaaactgtat
gattccaaaaacggtctactgaccaccattgcctggggaattgatggaaaagttgaatat
gctctggaaggaagtatctttattgcaggtgctgccatccagtggttgagggatggttta
aaggtattggaagaagctccggactccgaatactttgccagcaaggttgcggataccgac
ggtgtgtacctggtgcctgcctttgccggactgggcgctccctactgggatatgcgggca
aggggcgccattgtgggcctgacccgcggtactaccaaggagcatattattagggccgcg
ctggattctctggcttatcaaaccaaggatgtgctgggagctatggaagcagactccaac
ataaaattgcaagctttaaaagtagacggcggggcagtggccaacaacctgctcatgcaa
ttccaggccgatatcctgggtgtaccggtagaaagacccaaggttattgaaaccactgcc
ctgggcgctgcctacctggccggtctagctgttggcttctggcaaagcaaagaagagctg
gccagccgctggcaactggatcgccggtttgagagccaaatggacgacaccaagagaaat
aaactttatgacggttggaagcgcgcagttactcggagtatggattgggccattgaagat
taa

DBGET integrated database retrieval system